Potri.009G096300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G15290 322 / 2e-110 ATTIC21, TIC21, CIA5, PIC1 PERMEASE IN CHLOROPLASTS 1, CHLOROPLAST IMPORT APPARATUS 5, translocon at inner membrane of chloroplasts 21 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G300500 483 / 3e-174 AT2G15290 331 / 3e-114 PERMEASE IN CHLOROPLASTS 1, CHLOROPLAST IMPORT APPARATUS 5, translocon at inner membrane of chloroplasts 21 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014100 334 / 2e-115 AT2G15290 328 / 3e-113 PERMEASE IN CHLOROPLASTS 1, CHLOROPLAST IMPORT APPARATUS 5, translocon at inner membrane of chloroplasts 21 (.1)
Lus10019814 327 / 7e-113 AT2G15290 325 / 6e-112 PERMEASE IN CHLOROPLASTS 1, CHLOROPLAST IMPORT APPARATUS 5, translocon at inner membrane of chloroplasts 21 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF12263 DUF3611 Protein of unknown function (DUF3611)
Representative CDS sequence
>Potri.009G096300.1 pacid=42772367 polypeptide=Potri.009G096300.1.p locus=Potri.009G096300 ID=Potri.009G096300.1.v4.1 annot-version=v4.1
ATGCAAACGCTACTCCTGCCGGCGGTTCGCTCTGGCACGGCGTATTCCGCGGCGGTGGGACCAACGCCTCCTCTCGTACACCGCCTAAGTCACCGAGCAC
TCCCCTCTCCTCCGAATACTCTCTCAACCTCTCATAAATCCACACAACCTCTACCATTATTCTCTTACAGTAGCTCATTATCTAGTTACGATCCTCTCAA
GAACGAAACATCAAAACTTTTATCTACCCAAACAAACGCTTCCAATGCAACTGCTCCTGCTTTCAATTCCCAAAACGACGAGGCAGAAAGGGCAAAACTC
GCTCAGGTGGCAAAGAGATTAGAGAATACATCAAGGTATTTTAAGCGGCTGGGTAATCTAGGATTCTGGGGGCAGCTAATATGTGCTACAGTGGCAGCTG
TGATTCTTTCGTTTTCTGTTGTTGTCACTGGGAAGATCCCATCGCCTCCTACTTTTTATGCCACTCTTGGTGGGATTGCAGCTGCATTCATTTCTGTGTT
CTGGTCATTTGGGTACATTCGGCTTTCTGAGAAGCTGCGAAAAACTGCTAATGATCCTTCCAAGGCACCTCCTCGTGCTGATGTTGTGAAAAGCTTGAAA
AATGGTATAGTACTGAACCTGTTGGGAATGGGAGCAGCCATTCTTGGCATGCAAGCCACAGTGGGATTGTTGGTTGCAAAGGCTCTAACTTCCTCTGCAA
ATCCTTATTACCAGCAAATGACTCCTGGTTACAGTCCAGTTCTTGCGCTGGATGTGTTTTTGGTGCAGGCGTCAGCAAACACCATCCTTTCGCACTTCCT
GGGGCTCGTATTCTCCTTGGAACTCTTGCGCTCAGTGACACTACCACCGTCAGAAAGTCTTCCAGTCTTTAAGGTGGCATAA
AA sequence
>Potri.009G096300.1 pacid=42772367 polypeptide=Potri.009G096300.1.p locus=Potri.009G096300 ID=Potri.009G096300.1.v4.1 annot-version=v4.1
MQTLLLPAVRSGTAYSAAVGPTPPLVHRLSHRALPSPPNTLSTSHKSTQPLPLFSYSSSLSSYDPLKNETSKLLSTQTNASNATAPAFNSQNDEAERAKL
AQVAKRLENTSRYFKRLGNLGFWGQLICATVAAVILSFSVVVTGKIPSPPTFYATLGGIAAAFISVFWSFGYIRLSEKLRKTANDPSKAPPRADVVKSLK
NGIVLNLLGMGAAILGMQATVGLLVAKALTSSANPYYQQMTPGYSPVLALDVFLVQASANTILSHFLGLVFSLELLRSVTLPPSESLPVFKVA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G15290 ATTIC21, TIC21,... PERMEASE IN CHLOROPLASTS 1, CH... Potri.009G096300 0 1
AT3G56160 Sodium Bile acid symporter fam... Potri.008G021600 6.48 0.8328
AT5G22300 AtNIT4, NIT4 nitrilase 4 (.1) Potri.004G199600 9.53 0.8448 Pt-NIT2.2
AT1G77360 Tetratricopeptide repeat (TPR)... Potri.003G045800 11.40 0.8466
AT5G48220 Aldolase-type TIM barrel famil... Potri.014G169100 13.07 0.8263
AT4G29680 Alkaline-phosphatase-like fami... Potri.018G066600 13.71 0.7995
AT4G17600 LIL3:1 Chlorophyll A-B binding family... Potri.003G083500 13.89 0.8610 LIL3.2,Lil3_2
AT3G06050 PRXIIF, ATPRXII... peroxiredoxin IIF (.1) Potri.019G024000 15.16 0.8607 PtrcPrxIIF,Pt-PRX.1
AT3G52950 CBS / octicosapeptide/Phox/Bem... Potri.007G098400 15.29 0.8236
Potri.010G239400 39.39 0.7988
AT5G28750 Bacterial sec-independent tran... Potri.005G053400 46.66 0.8394

Potri.009G096300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.