Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	ATHM3.1,PtrTrxm5
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G15570 193 / 2e-63 TRX-M3, GAT1, ATHM3, ATM3 THIOREDOXIN-M3, GFP ARRESTED TRAFFICKING 1, Arabidopsis thioredoxin M-type 3, Thioredoxin superfamily protein (.1.2) AT3G15360 120 / 1e-34 ATHM4, ATM4, TRX-M4 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) AT1G03680 100 / 3e-27 ATHM1, ATM1, TRX-M1 ARABIDOPSIS THIOREDOXIN M-TYPE 1, thioredoxin M-type 1 (.1) AT4G03520 97 / 9e-26 ATHM2 Thioredoxin superfamily protein (.1.2) AT1G76760 79 / 1e-18 ATY1, TRX-Y1 thioredoxin Y1 (.1) AT1G43560 75 / 3e-17 ATY2 thioredoxin Y2 (.1) AT4G12170 70 / 8e-16 Thioredoxin superfamily protein (.1) AT1G50320 68 / 1e-14 ATHX, ATX thioredoxin X (.1) AT1G52990 69 / 3e-14 thioredoxin family protein (.1) AT3G06730 59 / 2e-11 TRXz, TRXP ,TRX z thioredoxin putative plastidic, Thioredoxin z (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G120700 [exp] 132 / 2e-39 AT3G15360 190 / 1e-61 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Potri.005G058400 [exp] 130 / 7e-39 AT4G03520 157 / 6e-49 Thioredoxin superfamily protein (.1.2) Potri.001G401500 [exp] 129 / 2e-38 AT3G15360 171 / 2e-54 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Potri.019G111200 [exp] 127 / 2e-37 AT4G03520 172 / 9e-55 Thioredoxin superfamily protein (.1.2) Potri.013G132200 [exp] 121 / 5e-35 AT4G03520 173 / 4e-55 Thioredoxin superfamily protein (.1.2) Potri.004G140500 [exp] 115 / 2e-32 ATCG00900 249 / 2e-85 CHLOROPLAST RIBOSOMAL PROTEIN S7, Ribosomal protein S7p/S5e family protein (.1) Potri.002G073000 [exp] 113 / 8e-32 AT4G03520 152 / 6e-47 Thioredoxin superfamily protein (.1.2) Potri.005G186800 [exp] 112 / 1e-31 AT4G03520 152 / 3e-47 Thioredoxin superfamily protein (.1.2) Potri.007G074000 [exp] 78 / 3e-18 AT1G50320 201 / 3e-66 thioredoxin X (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019847 [exp] 213 / 1e-71 AT2G15570 184 / 8e-60 THIOREDOXIN-M3, GFP ARRESTED TRAFFICKING 1, Arabidopsis thioredoxin M-type 3, Thioredoxin superfamily protein (.1.2) Lus10014069 [exp] 211 / 1e-70 AT2G15570 182 / 3e-59 THIOREDOXIN-M3, GFP ARRESTED TRAFFICKING 1, Arabidopsis thioredoxin M-type 3, Thioredoxin superfamily protein (.1.2) Lus10014798 [exp] 130 / 7e-39 AT3G15360 181 / 2e-58 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10040887 [exp] 130 / 1e-38 AT3G15360 182 / 4e-59 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10029755 [exp] 120 / 8e-35 AT3G15360 162 / 3e-51 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10029752 [exp] 120 / 9e-35 AT3G15360 165 / 3e-52 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10042784 [exp] 119 / 1e-34 AT3G15360 165 / 4e-52 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10018875 [exp] 74 / 9e-17 AT1G76760 176 / 6e-57 thioredoxin Y1 (.1) Lus10028569 [exp] 73 / 1e-16 AT1G76760 174 / 3e-56 thioredoxin Y1 (.1) Lus10014186 [exp] 60 / 1e-11 AT3G08710 192 / 3e-64 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [poplar] [flax] Thioredoxin PF00085 [poplar] [flax] Thioredoxin Thioredoxin
Representative CDS sequence Show only first row Show all	>Potri.009G100700.1 pacid=42771484 polypeptide=Potri.009G100700.1.p locus=Potri.009G100700 ID=Potri.009G100700.1.v4.1 annot-version=v4.1 ATGGCTTCAAGTGCTACTTCACTTTACTCCCCACCACTCACGAGCTCACGCGCCGCCGTTCTCCACCAATGTCAGCAGCTGAACCCTAACAGACTCTCTT TTCCAAGCGACTTCAACACCGCTAAAAGAGCAACGAATCTCACTGTTCAACACGTGCCTCTCCCTCTCAAGGTTCTCTGCGGTCGCGGAAACCGAGCTAC AGCTGTTACTCAGGACTCTTGGGAGAATTCAATTTTGAAAAGTGATATTCCTGTTCTTGTTGAATTCTATGCAAGTTGGTGTGGGCCTTGCAGGATGGTT CATCGAGTAATTGATGAGATTGCAGCAGAGTATGATGGGAAACTCAAATGCTTTGTGCTTAACACGGACAATGACCTTCAAATTGCTGAGGACTATGAAA TTAAGGCGGTACCAGTTGTTCTACTTTTCAAGAATGGAGAGAAGCGAGAGTCGGTGGTCGGTACCATGCCGAAGGAATTCTATATTGCTGCAGTTGAGAG AGTTCTGCAGTCGTAA
AA sequence Show only first row Show all	>Potri.009G100700.1 pacid=42771484 polypeptide=Potri.009G100700.1.p locus=Potri.009G100700 ID=Potri.009G100700.1.v4.1 annot-version=v4.1 MASSATSLYSPPLTSSRAAVLHQCQQLNPNRLSFPSDFNTAKRATNLTVQHVPLPLKVLCGRGNRATAVTQDSWENSILKSDIPVLVEFYASWCGPCRMV HRVIDEIAAEYDGKLKCFVLNTDNDLQIAEDYEIKAVPVVLLFKNGEKRESVVGTMPKEFYIAAVERVLQS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G15570		TRX-M3, GAT1, A...	THIOREDOXIN-M3, GFP ARRESTED T...		Potri.009G100700 [exp]	0	1	ATHM3.1,PtrTrxm5
AT2G46170			Reticulon family protein (.1.2...		Potri.014G091200 [exp]	4.58	0.8348
AT2G02180		TOM3	tobamovirus multiplication pro...		Potri.008G144400 [exp]	7.07	0.8413	Pt-TOM3.1
AT3G26370			O-fucosyltransferase family pr...		Potri.008G185200 [exp]	11.61	0.8115
AT3G24160		PMP	putative type 1 membrane prote...		Potri.003G178400 [exp]	15.87	0.8117	Pt-PMP.2
AT5G05670			signal recognition particle bi...		Potri.002G020900 [exp]	19.62	0.7714
AT4G27880			Protein with RING/U-box and TR...		Potri.015G013000 [exp]	20.71	0.7919
AT2G38050		DWF6, DET2, ATD...	DWARF 6, DE-ETIOLATED 2, 3-oxo...		Potri.016G110600 [exp]	23.23	0.7774	Pt-DET2.1
AT5G55950			Nucleotide/sugar transporter f...		Potri.001G370800 [exp]	24.89	0.8344
AT5G12870	MYB	ATMYB46	myb domain protein 46 (.1)		Potri.001G258700 [exp]	26.26	0.8175
AT3G53000		ATPP2-A15	phloem protein 2-A15 (.1)		Potri.006G117600 [exp]	26.72	0.7636

Compare expression of checked genes

Potri.009G100700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.