Potri.009G102201 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.009G102201.1 pacid=42770970 polypeptide=Potri.009G102201.1.p locus=Potri.009G102201 ID=Potri.009G102201.1.v4.1 annot-version=v4.1
ATGTGGATAGAGCGTCTGTTTCCTAAGCAGAAAGTCGTAGGTTCGACCCCTACCTGGCGCGATCCTACCATTTTTGGGCCCCATAAATTCGAGTATGGGC
CGGCGGCTCCTTCTTGGCCCAGTTCTATATATATCTCAGAAAATCAGAGACCATCAATTTCGTTCTTTCTGATTCAGCCGCCATCTTCGCCGGATGAAGG
CTTTACTAGCAAACAACGATGTGAGTTTGTTAACGAAGATAAAGTCAAATCTTTGGTGGAAATACGGAGTAAAGACTCAATTCTATGCAAATTAAGGCAG
ATGTTCCTAATAATATAG
AA sequence
>Potri.009G102201.1 pacid=42770970 polypeptide=Potri.009G102201.1.p locus=Potri.009G102201 ID=Potri.009G102201.1.v4.1 annot-version=v4.1
MWIERLFPKQKVVGSTPTWRDPTIFGPHKFEYGPAAPSWPSSIYISENQRPSISFFLIQPPSSPDEGFTSKQRCEFVNEDKVKSLVEIRSKDSILCKLRQ
MFLII

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.009G102201 0 1
Potri.001G302201 6.00 0.8928
Potri.001G302801 16.24 0.8190
AT4G16580 Protein phosphatase 2C family ... Potri.001G089201 20.49 0.8010
AT4G26590 ATOPT5 ARABIDOPSIS THALIANA OLIGOPEPT... Potri.001G370100 22.58 0.8728 Pt-OPT1.1
AT5G20310 Adenine nucleotide alpha hydro... Potri.018G147200 32.72 0.8726
AT3G54070 Ankyrin repeat family protein ... Potri.011G016400 38.05 0.8688
AT3G54070 Ankyrin repeat family protein ... Potri.006G281500 40.36 0.8683
Potri.004G166400 42.19 0.8575
AT3G18670 Ankyrin repeat family protein ... Potri.011G019500 45.49 0.8450
Potri.001G422000 45.71 0.7845

Potri.009G102201 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.