Plant FIBer expression Database

Potri.009G102600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G16210 40 / 0.0004 F-box family protein (.1)
AT4G03220 39 / 0.0008 Protein with RNI-like/FBD-like domains (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.009G102600.2 pacid=42772874 polypeptide=Potri.009G102600.2.p locus=Potri.009G102600 ID=Potri.009G102600.2.v4.1 annot-version=v4.1
ATGGGTACTGCTGGGACTCTAGACAGATTCAGAAATCTTCCTCACAAAATTGCTTATCAGATTCTTCTCTTTATTTCCATGGGAGAGCTTGCTCGATTCA
GATTGGTTTCTAAGAGATGTAAAAGATGGATGGATCTGCGTCAGGATGATGGCATCAAGATTTCAACATTGTATCTCAATCGGTCCTTCGAGGGAAGCTA
TTCTTACGAAGAATTCTACGTTGGCAAATTGTTGTCTCAGGCTGCGGGTTCTGAAGTTGAACAACTTAAGATAGAAGTTATTACCAGGTCTGATACTGCT
TTTGAACTACCAGTTTCGGTCTTGAAATGCGAACCCTTGACGATTCTTATGCTTATCTTGACGAACCAAGGCATTGTGAGATTTCCCTCGTTATCGTCTT
CTTATTTCTACAATTCTCAAACAATTAAAGTTAGAAAATGTACATCCAGAGTATGA
AA sequence
>Potri.009G102600.2 pacid=42772874 polypeptide=Potri.009G102600.2.p locus=Potri.009G102600 ID=Potri.009G102600.2.v4.1 annot-version=v4.1
MGTAGTLDRFRNLPHKIAYQILLFISMGELARFRLVSKRCKRWMDLRQDDGIKISTLYLNRSFEGSYSYEEFYVGKLLSQAAGSEVEQLKIEVITRSDTA
FELPVSVLKCEPLTILMLILTNQGIVRFPSLSSSYFYNSQTIKVRKCTSRV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.009G102600
[exp]
0 1
Potri.003G158902
[exp]
10.09 0.6500
AT5G53820 Late embryogenesis abundant pr... Potri.004G106350
[exp]
18.97 0.5787
AT2G22440 unknown protein Potri.001G266504
[exp]
27.49 0.5172
Potri.012G116401
[exp]
27.94 0.5705
AT4G09720 AtRABG3a RAB GTPase homolog G3A (.1.2.3... Potri.007G079700
[exp]
33.27 0.5173
Potri.017G071950
[exp]
40.00 0.5539
AT1G21430 YUC11 Flavin-binding monooxygenase f... Potri.016G003300
[exp]
43.37 0.4979 FML10
AT2G31335 unknown protein Potri.019G012603
[exp]
44.54 0.4997
AT3G47440 TIP5;1 tonoplast intrinsic protein 5;... Potri.003G108500
[exp]
48.98 0.6027 Pt-TIP5.1
AT3G04900 Heavy metal transport/detoxifi... Potri.001G326100
[exp]
50.34 0.4758

Potri.009G102600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.