Potri.009G105500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G49590 222 / 1e-72 C2H2 and C2HC zinc fingers superfamily protein (.1.2.3)
AT3G54230 41 / 0.0005 SUA suppressor of abi3-5 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G081800 45 / 3e-05 AT3G54230 855 / 0.0 suppressor of abi3-5 (.1.2)
Potri.017G138500 43 / 0.0002 AT3G54230 855 / 0.0 suppressor of abi3-5 (.1.2)
Potri.017G138401 42 / 0.0002 AT3G54230 166 / 1e-45 suppressor of abi3-5 (.1.2)
Potri.001G205700 41 / 0.0005 AT5G09390 280 / 3e-91 CD2-binding protein-related (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027913 255 / 1e-85 AT1G49590 278 / 5e-95 C2H2 and C2HC zinc fingers superfamily protein (.1.2.3)
Lus10012068 265 / 3e-82 AT5G39710 1028 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10010955 43 / 0.0002 AT3G54230 943 / 0.0 suppressor of abi3-5 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0361 C2H2-zf PF06220 zf-U1 U1 zinc finger
Representative CDS sequence
>Potri.009G105500.1 pacid=42771535 polypeptide=Potri.009G105500.1.p locus=Potri.009G105500 ID=Potri.009G105500.1.v4.1 annot-version=v4.1
ATGACGGAGTATTGGGTAAGCCAAGGCAACAAATGGTGCGATTTTTGCAAGATATTTATATCAAACAACCCTACAAGTATCCGAAACCATGAACTTGGCC
AACGCCACAAAGATAATGTCGCTAAAAAGCTTGATTCTATGCGGAAAGATAACATCGCCAAGGAGAAACAGCAGAAAGAAGCTGCCCGTGCTCTCGAGCA
GATCGAAGCTAAAGCAAATCGGAGTTATCAAAAGGATGTGGCGAATCTTAAGGAGGCAAGTAGTCTTCGTGCATTGGATATACAAGAAGATGGTCAAGAG
AAGTGGGATTATGACAGCACTTCAGGCTATTATTACAATCAAAGCAATGGTTTACACTATGATCCAAACTCAGGCTTTTACTATTCTGATGCTATAGGCA
AGTGGGTGACGCAAGAAGAAGCGTATGCTGCGGTTCGGATTTCATCAGGCTCCAGGAATAAAGAATCCAGTTTTAAAAAGCCTTTGCCAGCATCAGCTGT
CAGTTCGGTAAAAGAAAATAAAGTCGCTGCTCAAAGTGGCCCTCCACCTGGTCCGGTAGTTTCAGCTTCTTTAAATCCTAGAAGATCTGTTAAAGGCGCT
CCTTCAAAATTTGCTGTTAACAAGAGGAAGAGGCCAGATGAAAAGCCAAAGGCTGTATCTGTAGAAGAAAAGGCGGCACTTAAAGCTAGGGAAGCTGCAA
GGAAGAGGGTCGAGGAGAGGGAGAAATCATTGCTTGGCCTTTACCAACACTGA
AA sequence
>Potri.009G105500.1 pacid=42771535 polypeptide=Potri.009G105500.1.p locus=Potri.009G105500 ID=Potri.009G105500.1.v4.1 annot-version=v4.1
MTEYWVSQGNKWCDFCKIFISNNPTSIRNHELGQRHKDNVAKKLDSMRKDNIAKEKQQKEAARALEQIEAKANRSYQKDVANLKEASSLRALDIQEDGQE
KWDYDSTSGYYYNQSNGLHYDPNSGFYYSDAIGKWVTQEEAYAAVRISSGSRNKESSFKKPLPASAVSSVKENKVAAQSGPPPGPVVSASLNPRRSVKGA
PSKFAVNKRKRPDEKPKAVSVEEKAALKAREAARKRVEEREKSLLGLYQH

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G49590 C2H2 and C2HC zinc fingers sup... Potri.009G105500 0 1
AT1G53490 RING/U-box superfamily protein... Potri.001G383900 15.58 0.7586
AT5G53310 myosin heavy chain-related (.1... Potri.015G023400 24.00 0.7844
AT1G19440 KCS4 3-ketoacyl-CoA synthase 4 (.1) Potri.014G196200 34.08 0.7645
AT5G55090 MAPKKK15 mitogen-activated protein kina... Potri.003G130000 45.03 0.7575
Potri.006G233301 46.66 0.7501
AT4G35870 early-responsive to dehydratio... Potri.007G063700 73.48 0.6677
AT5G25360 unknown protein Potri.001G192700 86.00 0.6872
AT2G37370 unknown protein Potri.016G080900 129.35 0.6854
AT2G18670 RING/U-box superfamily protein... Potri.018G098100 130.65 0.6867
AT5G20120 unknown protein Potri.018G066700 133.49 0.6903

Potri.009G105500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.