Potri.009G106000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G15780 152 / 3e-46 Cupredoxin superfamily protein (.1)
AT2G15770 114 / 5e-31 Cupredoxin superfamily protein (.1)
AT4G33930 77 / 5e-17 Cupredoxin superfamily protein (.1)
AT4G34300 68 / 8e-14 Cupredoxin superfamily protein (.1)
AT3G27200 47 / 1e-06 Cupredoxin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G030000 41 / 0.0001 AT3G17675 106 / 2e-30 Cupredoxin superfamily protein (.1)
Potri.001G332200 40 / 0.0002 AT3G27200 171 / 5e-55 Cupredoxin superfamily protein (.1)
Potri.013G030450 40 / 0.0002 AT3G17675 106 / 2e-30 Cupredoxin superfamily protein (.1)
Potri.019G037800 39 / 0.0005 AT3G17675 98 / 4e-27 Cupredoxin superfamily protein (.1)
Potri.013G054500 39 / 0.0007 AT3G17675 91 / 3e-24 Cupredoxin superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009079 173 / 1e-55 AT2G15780 143 / 8e-43 Cupredoxin superfamily protein (.1)
Lus10025269 172 / 5e-55 AT2G15780 141 / 4e-42 Cupredoxin superfamily protein (.1)
Lus10002618 44 / 5e-06 AT3G27200 89 / 2e-23 Cupredoxin superfamily protein (.1)
Lus10022350 41 / 0.0001 AT3G27200 169 / 7e-54 Cupredoxin superfamily protein (.1)
Lus10041570 40 / 0.0002 AT3G27200 167 / 2e-53 Cupredoxin superfamily protein (.1)
Lus10027043 39 / 0.0005 AT1G72230 112 / 4e-31 Cupredoxin superfamily protein (.1)
Lus10002614 38 / 0.001 AT2G32300 100 / 1e-26 uclacyanin 1 (.1)
PFAM info
Representative CDS sequence
>Potri.009G106000.1 pacid=42772852 polypeptide=Potri.009G106000.1.p locus=Potri.009G106000 ID=Potri.009G106000.1.v4.1 annot-version=v4.1
ATGGCTCGTCTAACACATGCACAGGTACTCATCCTTCTGCTTAGTGCTTCCATGTGGGCAATAAGCATGGCAAGCAGGCAATATGGTTTCAACAACACTG
ATTGGAGTTACAAGCGTCGCCCTTGTCGCCAAAACAGTACAGCTGCACCCAACAAGATCGTTGTGGGTGGATCTCAAAATTGGACGTTCGGTATCAACTA
CGCTGATTGGGCTCTCAAAAACGGCCCATTCTACTTCAATGACACTCTAGTGTTCAAGTATGATCCACCCAGTGACACAAACACCCATCCTCACAGTGTC
TACTTGCTACCAAACCTGTGGAGCTTCTTAAAATGTGACCTGAGCAGAGCCAAGTTGGTTGCTAGCGAGACACAAGGAGGTGGTGATGGGTTCGAGTTCG
TGCTCAAGAGCTGGCAACCTCATTACTTTGCTTGCGGCGGAGGTGCTGGCTTCCACTGTAATAACGGCACCATGAAGTTCTTTGTCATGCCAATGTTTCG
TCGTCGGTATTGA
AA sequence
>Potri.009G106000.1 pacid=42772852 polypeptide=Potri.009G106000.1.p locus=Potri.009G106000 ID=Potri.009G106000.1.v4.1 annot-version=v4.1
MARLTHAQVLILLLSASMWAISMASRQYGFNNTDWSYKRRPCRQNSTAAPNKIVVGGSQNWTFGINYADWALKNGPFYFNDTLVFKYDPPSDTNTHPHSV
YLLPNLWSFLKCDLSRAKLVASETQGGGDGFEFVLKSWQPHYFACGGGAGFHCNNGTMKFFVMPMFRRRY

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G15780 Cupredoxin superfamily protein... Potri.009G106000 0 1
AT3G30380 alpha/beta-Hydrolases superfam... Potri.017G102500 1.00 0.9515
AT1G11580 ATPMEPCRA methylesterase PCR A (.1) Potri.011G025400 1.73 0.9201
AT5G51760 AHG1 ABA-hypersensitive germination... Potri.015G133900 2.00 0.9247
AT5G03980 SGNH hydrolase-type esterase s... Potri.005G024900 4.24 0.8953
AT5G51060 ATRBOHC, RHD2 ROOT HAIR DEFECTIVE 2, A. THAL... Potri.015G109800 4.89 0.8831 RHD2.2
AT3G48530 KING1 SNF1-related protein kinase re... Potri.009G118700 4.89 0.8938
AT5G57500 Galactosyltransferase family p... Potri.018G094000 7.48 0.9122
AT1G07900 AS2 LBD1 LOB domain-containing protein ... Potri.014G167100 9.00 0.8932
AT3G57540 Remorin family protein (.1) Potri.006G053200 10.00 0.8644
AT1G61560 ATMLO6, MLO6 MILDEW RESISTANCE LOCUS O 6, S... Potri.011G058900 11.22 0.8789

Potri.009G106000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.