Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G19000 143 / 9e-43 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT3G19010 124 / 3e-35 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) AT2G44800 51 / 7e-08 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G10500 50 / 2e-07 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G59530 49 / 5e-07 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G06620 48 / 7e-07 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G15550 48 / 8e-07 ATGA3OX1, GA4 GA REQUIRING 4, ARABIDOPSIS THALIANA GIBBERELLIN 3 BETA-HYDROXYLASE 1, gibberellin 3-oxidase 1 (.1) AT3G61400 48 / 9e-07 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G13610 47 / 1e-06 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G16330 47 / 2e-06 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G146000 [exp] 197 / 8e-63 AT3G19000 357 / 3e-122 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.004G146100 [exp] 191 / 3e-60 AT3G19000 374 / 5e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.009G107550 [exp] 149 / 3e-44 AT3G19000 452 / 2e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.009G107600 [exp] 148 / 7e-44 AT3G19000 459 / 4e-163 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.001G176600 [exp] 55 / 4e-09 AT1G15550 452 / 1e-159 GA REQUIRING 4, ARABIDOPSIS THALIANA GIBBERELLIN 3 BETA-HYDROXYLASE 1, gibberellin 3-oxidase 1 (.1) Potri.010G023550 [exp] 53 / 5e-09 AT3G21420 210 / 6e-68 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.010G023600 [exp] 53 / 1e-08 AT3G21420 511 / 0.0 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.003G057400 [exp] 53 / 2e-08 AT1G15550 451 / 2e-159 GA REQUIRING 4, ARABIDOPSIS THALIANA GIBBERELLIN 3 BETA-HYDROXYLASE 1, gibberellin 3-oxidase 1 (.1) Potri.001G451700 [exp] 51 / 6e-08 AT4G10500 451 / 6e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021002 [exp] 158 / 2e-47 AT3G19000 389 / 3e-135 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10023851 [exp] 136 / 4e-39 AT3G19000 474 / 9e-169 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10020999 [exp] 129 / 2e-36 AT3G19000 473 / 3e-168 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10042155 [exp] 67 / 6e-14 AT3G19000 219 / 1e-71 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10004245 [exp] 58 / 3e-10 AT3G19010 277 / 2e-92 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) Lus10005037 [exp] 55 / 4e-09 AT3G11180 471 / 3e-166 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10037292 [exp] 54 / 6e-09 AT4G16330 416 / 5e-145 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10011476 [exp] 50 / 1e-07 AT1G15550 412 / 1e-143 GA REQUIRING 4, ARABIDOPSIS THALIANA GIBBERELLIN 3 BETA-HYDROXYLASE 1, gibberellin 3-oxidase 1 (.1) Lus10023113 [exp] 50 / 2e-07 AT1G15550 171 / 1e-51 GA REQUIRING 4, ARABIDOPSIS THALIANA GIBBERELLIN 3 BETA-HYDROXYLASE 1, gibberellin 3-oxidase 1 (.1) Lus10004387 [exp] 49 / 5e-07 AT3G11180 509 / 0.0 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [poplar] [flax] Cupin PF14226 [poplar] [flax] DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Representative CDS sequence Show only first row Show all	>Potri.009G107350.1 pacid=42771810 polypeptide=Potri.009G107350.1.p locus=Potri.009G107350 ID=Potri.009G107350.1.v4.1 annot-version=v4.1 ATGGGAGAGGTTGATCCAGCCTTCATTCAAGCCCAAGAACACAGGCCGAAACCTGAGATCACTAGAGCAGAAGGAATACCCTTAATTGATCTTTCCATAA TCAGCTCTCCTAATTCCAACTTAGACAACGATCAAGCACTTGGTGGTCTTGTTGAGGAAATAGGCAATGCATGCAAAGATTGGGGATTTTTTCAAGTGAT CAATCATGGGGTGCCGCTTGCTAAGCGACACAACATTGAGAAAGCATCAAGAGAATTTTTTGGTCAGCCTCTGGAAGAGAAAAGGAAGGTGAGGAGAAAT GAGGAGAAAGTGTTGGGTTATTATGACACTGAGCATACCAAGAATGTTAGGGACTGGAAAGAAGTGTTCGATCTCAAAGTCCAGGATCCAACGGCTGTCC CTGCTTCATATAAGCCTGATGATGAGGAACTAACCAAGTGGTTTAATCAGTGGCCTGAATACCCCAATGACCTGAGGTATATACTATTGTTTTCTCTCTT CTTCTGA
AA sequence Show only first row Show all	>Potri.009G107350.1 pacid=42771810 polypeptide=Potri.009G107350.1.p locus=Potri.009G107350 ID=Potri.009G107350.1.v4.1 annot-version=v4.1 MGEVDPAFIQAQEHRPKPEITRAEGIPLIDLSIISSPNSNLDNDQALGGLVEEIGNACKDWGFFQVINHGVPLAKRHNIEKASREFFGQPLEEKRKVRRN EEKVLGYYDTEHTKNVRDWKEVFDLKVQDPTAVPASYKPDDEELTKWFNQWPEYPNDLRYILLFSLFF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G19000			2-oxoglutarate (2OG) and Fe(II...		Potri.009G107350 [exp]	0	1
AT1G29150		RPN6, ATS9	REGULATORY PARTICLE NON-ATPASE...		Potri.006G277900 [exp]	18.89	0.5698
AT1G64460			Protein kinase superfamily pro...		Potri.002G171400 [exp]	60.09	0.5662
AT4G00090			Transducin/WD40 repeat-like su...		Potri.002G148100 [exp]	121.45	0.5013

Compare expression of checked genes

Potri.009G107350 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.