Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G19000 452 / 2e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT3G19010 433 / 1e-152 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) AT4G10500 189 / 4e-57 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G21420 187 / 2e-56 LBO1 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G10490 182 / 1e-54 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G17020 181 / 7e-54 ATSRG1, SRG1 senescence-related gene 1 (.1) AT2G38240 174 / 2e-51 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G25420 172 / 1e-50 AT2301, GA5, ATGA20OX1 GA REQUIRING 5, ARABIDOPSIS THALIANA GIBBERELLIN 20-OXIDASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G11180 170 / 2e-49 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT5G24530 168 / 4e-49 DMR6 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G107600 [exp] 649 / 0 AT3G19000 459 / 4e-163 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.004G146000 [exp] 444 / 1e-156 AT3G19000 357 / 3e-122 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.004G146100 [exp] 439 / 1e-154 AT3G19000 374 / 5e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.010G023600 [exp] 193 / 2e-58 AT3G21420 511 / 0.0 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.009G107350 [exp] 181 / 2e-56 AT3G19000 144 / 7e-43 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.011G150100 [exp] 182 / 2e-54 AT4G10490 501 / 2e-179 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G451900 [exp] 181 / 4e-54 AT4G10490 498 / 3e-178 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.005G223000 [exp] 180 / 1e-53 AT4G10500 238 / 3e-76 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.006G101200 [exp] 179 / 4e-53 AT5G05600 474 / 3e-168 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023851 [exp] 492 / 7e-176 AT3G19000 474 / 9e-169 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10020999 [exp] 488 / 2e-174 AT3G19000 473 / 3e-168 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10021002 [exp] 409 / 2e-143 AT3G19000 389 / 3e-135 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10004245 [exp] 263 / 5e-87 AT3G19010 277 / 2e-92 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) Lus10023850 [exp] 242 / 1e-79 AT3G19000 225 / 4e-73 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10042155 [exp] 198 / 2e-62 AT3G19000 219 / 1e-71 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10006518 [exp] 189 / 9e-57 AT3G21420 523 / 0.0 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10030995 [exp] 184 / 4e-55 AT1G17020 339 / 2e-115 senescence-related gene 1 (.1) Lus10005037 [exp] 184 / 1e-54 AT3G11180 471 / 3e-166 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10040112 [exp] 177 / 1e-52 AT1G17020 332 / 1e-112 senescence-related gene 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [poplar] [flax] Cupin PF03171 [poplar] [flax] 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily CL0029 [poplar] [flax] Cupin PF14226 [poplar] [flax] DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Representative CDS sequence Show only first row Show all	>Potri.009G107550.1 pacid=42771897 polypeptide=Potri.009G107550.1.p locus=Potri.009G107550 ID=Potri.009G107550.1.v4.1 annot-version=v4.1 ATGGGAGAAATCGATCCAGAATTCATTCAAGAAACAGAATACAGGCCTAAATTCAAAACAATAGAAGCTGATGAAGAAATCCCAGTTATTGATCTCTCTG TTTCCACTCCAAGTGCCACAAAAGAAGTTGTGTCAAAGATTGGAGAAGCGTGCAAGAAGTGGGGATTTTTTCAAGTGATCAATCATGGGGTACCGTTGGA ACTAAGGCAAAAGATAGAGAGGGTAGCAAAAGAATTCTTTGATCAACCGATGGAGGAAAAACGGAAGGTGAAGAGAGATGAGGTGAATCCTATGGGGTAT CATGATAGTGAGCACACCAAAAATATTAGGGACTGGAAGGAGGTTTTTGACTTCTTGGTGGTAGATCCAACTTTAATTCCTGCCTCTGGTGATCCTGATG ATAAAGAGCTAAGGGCTATGACTAATCAATGGCCACACAAACCTTCTGAATTCAGGGAGCTGTGCCAAGATTATACAAGACAGGTGGAAAAACTAGCTTT CAAGTTGCTGGAGCTTATCTCTTTGAGCTTAGGGTTGCCTGCTGATAGGTTAAATGGTTACTTCAAAGACCAAATCAGCTTTGCTAGGTTCAACCATTAC CCTCCTTGTCCTGCACCCCACCTAGCTCTTGGTGTAGGTAGGCACAAGGATGGAGGTGCCTTGACGGTCTTATCCCAAGATGATGTTGGAGGGCTGCAAA TAGGCCGCAGATCAGATGGAGAATGGATCCCTGCTAAACCAATTCCAGATGCCTTTATCATCAATATTGGCAATTGTATGCAGGTGTGGAGCAATGACTT GTACTGGAGTGCAGAGCATAGAGTGGTGGTGAATTCTCAAAGGGAAAGGTTCTCGATACCATTTTTCTTTTTCCCATCCCAATATGTTGATATTAAGCCA CTGGATGAGCTAATTAATGAGCAAAACCTTGCAAAGTACAAGGAATTCAACTGGGGAAAATTCTTTGCCAGTAGAAACCGCAGTGATTATAAAAAACGTG AAGTGGAAAACATCCAAATCGATCACTTTAAGGTACCAGAGTGA
AA sequence Show only first row Show all	>Potri.009G107550.1 pacid=42771897 polypeptide=Potri.009G107550.1.p locus=Potri.009G107550 ID=Potri.009G107550.1.v4.1 annot-version=v4.1 MGEIDPEFIQETEYRPKFKTIEADEEIPVIDLSVSTPSATKEVVSKIGEACKKWGFFQVINHGVPLELRQKIERVAKEFFDQPMEEKRKVKRDEVNPMGY HDSEHTKNIRDWKEVFDFLVVDPTLIPASGDPDDKELRAMTNQWPHKPSEFRELCQDYTRQVEKLAFKLLELISLSLGLPADRLNGYFKDQISFARFNHY PPCPAPHLALGVGRHKDGGALTVLSQDDVGGLQIGRRSDGEWIPAKPIPDAFIINIGNCMQVWSNDLYWSAEHRVVVNSQRERFSIPFFFFPSQYVDIKP LDELINEQNLAKYKEFNWGKFFASRNRSDYKKREVENIQIDHFKVPE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G19000			2-oxoglutarate (2OG) and Fe(II...		Potri.009G107550 [exp]	0	1
AT3G19000			2-oxoglutarate (2OG) and Fe(II...		Potri.009G107600 [exp]	1.00	0.7999	2OGox7
AT4G29160		SNF7.1	SNF7 family protein (.1.2.3)		Potri.006G154000 [exp]	2.82	0.6568
AT4G39910		ATUBP3	ubiquitin-specific protease 3 ...		Potri.007G093600 [exp]	6.48	0.6774	Pt-UBP3.1
AT3G60680			Plant protein of unknown funct...		Potri.002G145000 [exp]	9.00	0.6556
AT3G08780			unknown protein		Potri.016G126200 [exp]	10.90	0.6571
AT3G06190		ATBPM2	BTB-POZ and MATH domain 2 (.1....		Potri.010G029500 [exp]	18.97	0.6623
AT3G47300		SELT	SELT-like protein precursor (....		Potri.009G047000 [exp]	27.78	0.6691
AT5G22950		VPS24.1	SNF7 family protein (.1)		Potri.004G215500 [exp]	27.96	0.6286
AT1G30500	CCAAT	NF-YA7	"nuclear factor Y, subunit A7"...		Potri.001G372100 [exp]	39.94	0.6229
AT3G26020			Protein phosphatase 2A regulat...		Potri.010G054300 [exp]	66.09	0.5949

Compare expression of checked genes

Potri.009G107550 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.