Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	2OGox7
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G19000 459 / 4e-163 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT3G19010 437 / 2e-154 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) AT4G10500 195 / 2e-59 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G21420 192 / 5e-58 LBO1 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G10490 187 / 2e-56 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G17020 182 / 3e-54 ATSRG1, SRG1 senescence-related gene 1 (.1) AT2G38240 176 / 3e-52 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G25420 176 / 1e-51 AT2301, GA5, ATGA20OX1 GA REQUIRING 5, ARABIDOPSIS THALIANA GIBBERELLIN 20-OXIDASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G24530 171 / 2e-50 DMR6 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G11180 172 / 3e-50 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G107550 [exp] 649 / 0 AT3G19000 452 / 2e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.004G146000 [exp] 446 / 2e-157 AT3G19000 357 / 3e-122 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.004G146100 [exp] 442 / 5e-156 AT3G19000 374 / 5e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.010G023600 [exp] 196 / 8e-60 AT3G21420 511 / 0.0 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.009G107350 [exp] 181 / 2e-56 AT3G19000 144 / 7e-43 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.011G150100 [exp] 186 / 4e-56 AT4G10490 501 / 2e-179 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G451900 [exp] 185 / 1e-55 AT4G10490 498 / 3e-178 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.005G223000 [exp] 182 / 1e-54 AT4G10500 238 / 3e-76 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.006G101200 [exp] 182 / 2e-54 AT5G05600 474 / 3e-168 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023851 [exp] 496 / 1e-177 AT3G19000 474 / 9e-169 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10020999 [exp] 490 / 3e-175 AT3G19000 473 / 3e-168 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10021002 [exp] 413 / 9e-145 AT3G19000 389 / 3e-135 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10004245 [exp] 269 / 3e-89 AT3G19010 277 / 2e-92 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) Lus10023850 [exp] 245 / 8e-81 AT3G19000 225 / 4e-73 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10042155 [exp] 202 / 1e-63 AT3G19000 219 / 1e-71 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10030995 [exp] 189 / 7e-57 AT1G17020 339 / 2e-115 senescence-related gene 1 (.1) Lus10006518 [exp] 188 / 1e-56 AT3G21420 523 / 0.0 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10005037 [exp] 185 / 4e-55 AT3G11180 471 / 3e-166 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10004808 [exp] 180 / 1e-53 AT5G05600 457 / 5e-162 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [poplar] [flax] Cupin PF03171 [poplar] [flax] 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily CL0029 [poplar] [flax] Cupin PF14226 [poplar] [flax] DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Representative CDS sequence Show only first row Show all	>Potri.009G107600.1 pacid=42771987 polypeptide=Potri.009G107600.1.p locus=Potri.009G107600 ID=Potri.009G107600.1.v4.1 annot-version=v4.1 ATGGGAGAAATCGATCCAGAATTCATTCAAGAAACAGAATACAGGCCTAAATTCAAAACAATAGAAGCTGATGAAGAAATCCCAGTTATTGATCTCTCTG TTTCCACTCCTAGTGACACAAAAGAAGTTGTGTCAAAGATTGGAGAAGCGTGCAAGAAGTGGGGATTTTTTCAAGTGATCAATCATGGGGTACCGTTGGA ACTAAGGCAAAAGATAGAGAAGGTAGCAAAAGAATTCTTTGATCAACCGATGGAGGAAAAACGGAAGGTGAAGAGAGATGAGGTGAATCCTATGGGGTAT CATGATAGTGAGCACACCAAAAATATTAGGGACTGGAAGGAGGTTTTTGACTTCTTGGTGGTAGATCCAACTTTAATTCCTGCCTCTGATGATCCTGATG ATAAAGAGCTAAGGGCTATGACTAATCAATGGCCACACAAACCTTCTGAATTCAGGGAGCTGTGCCAAGAATATACAAGACAGGTGGAAAAACTAGCTTT CAAGTTGCTGGAGCTTATCTCTTTGAGCTTAGGGTTGCCTGCTGATAGGTTAAATGGTTACTTCAAAGACCAAATCAGCTTTGCTAGGTTCAACCATTAC CCTCCTTGTCCTGCACCCCACCTAGCTCTTGGTGTAGGTAGGCACAAGGATGGAGGTGCCTTGACGGTCTTATCCCAAGATGATGTTGGAGGGCTGCAAA TAGGCCGCAGATCAGATGGAGAATGGATCCCTGTTAAACCAATTCCAGATGCCTTTATCATCAATATTGGTAATTGTATGCAGGTTTGGAGCAATGACTT GTACTGGAGTGCAGAGCATAGAGTGGTGGTGAATTCTCAAAGGGAAAGGTTCTCGATACCATTTTTCTTTTTCCCATCCCAATATGTTGATATTAAGCCA CTGGATGAGCTAATTAATGAGCAAAACCTTGCAAAGTACAAGGAATTCAACTGGGGAAAATTCTTTGCCAGTAGAAACCGCAGTGATTATAAAAAACGTG AAGTGGAAAACATCCAAATCGATCACTTTAAGGTACCAGAGTGA
AA sequence Show only first row Show all	>Potri.009G107600.1 pacid=42771987 polypeptide=Potri.009G107600.1.p locus=Potri.009G107600 ID=Potri.009G107600.1.v4.1 annot-version=v4.1 MGEIDPEFIQETEYRPKFKTIEADEEIPVIDLSVSTPSDTKEVVSKIGEACKKWGFFQVINHGVPLELRQKIEKVAKEFFDQPMEEKRKVKRDEVNPMGY HDSEHTKNIRDWKEVFDFLVVDPTLIPASDDPDDKELRAMTNQWPHKPSEFRELCQEYTRQVEKLAFKLLELISLSLGLPADRLNGYFKDQISFARFNHY PPCPAPHLALGVGRHKDGGALTVLSQDDVGGLQIGRRSDGEWIPVKPIPDAFIINIGNCMQVWSNDLYWSAEHRVVVNSQRERFSIPFFFFPSQYVDIKP LDELINEQNLAKYKEFNWGKFFASRNRSDYKKREVENIQIDHFKVPE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G19000			2-oxoglutarate (2OG) and Fe(II...		Potri.009G107600 [exp]	0	1	2OGox7
AT3G19000			2-oxoglutarate (2OG) and Fe(II...		Potri.009G107550 [exp]	1.00	0.7999
AT3G62770		ATATG18A	autophagy 18a, Transducin/WD40...		Potri.014G132300 [exp]	3.87	0.7840
AT5G22950		VPS24.1	SNF7 family protein (.1)		Potri.004G215500 [exp]	5.29	0.7295
AT4G01280	MYB		Homeodomain-like superfamily p...		Potri.014G089300 [exp]	6.32	0.7897
AT4G25440	C3HZnF	ZFWD1	zinc finger WD40 repeat protei...		Potri.012G134800 [exp]	7.07	0.7618
AT3G62140			unknown protein		Potri.014G112900 [exp]	7.74	0.7396
AT1G04770			Tetratricopeptide repeat (TPR)...		Potri.001G050600 [exp]	10.81	0.7464
AT2G46900			unknown protein		Potri.014G109500 [exp]	11.40	0.7351
AT1G04770			Tetratricopeptide repeat (TPR)...		Potri.003G177600 [exp]	15.39	0.6760
AT2G10950			BSD domain-containing protein ...		Potri.018G125400 [exp]	17.88	0.6854

Compare expression of checked genes

Potri.009G107600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.