Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G26500 96 / 2e-26 cytochrome b6f complex subunit (petM), putative (.1), cytochrome b6f complex subunit (petM), putative (.2), cytochrome b6f complex subunit (petM), putative (.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G147300 [exp] 120 / 4e-36 AT2G26500 54 / 3e-10 cytochrome b6f complex subunit (petM), putative (.1), cytochrome b6f complex subunit (petM), putative (.2), cytochrome b6f complex subunit (petM), putative (.3) Potri.002G130000 [exp] 97 / 5e-27 AT2G26500 73 / 2e-17 cytochrome b6f complex subunit (petM), putative (.1), cytochrome b6f complex subunit (petM), putative (.2), cytochrome b6f complex subunit (petM), putative (.3) Potri.014G037000 [exp] 96 / 2e-26 AT2G26500 79 / 1e-19 cytochrome b6f complex subunit (petM), putative (.1), cytochrome b6f complex subunit (petM), putative (.2), cytochrome b6f complex subunit (petM), putative (.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011665 [exp] 40 / 6e-05 AT2G26500 105 / 2e-30 cytochrome b6f complex subunit (petM), putative (.1), cytochrome b6f complex subunit (petM), putative (.2), cytochrome b6f complex subunit (petM), putative (.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF08041 [poplar] [flax] PetM PetM family of cytochrome b6f complex subunit 7
Representative CDS sequence Show only first row Show all	>Potri.009G108700.1 pacid=42772539 polypeptide=Potri.009G108700.1.p locus=Potri.009G108700 ID=Potri.009G108700.1.v4.1 annot-version=v4.1 ATGGCAACAGCCTCAGCAACGCTTTCTCCAGCAACACTTGCTGCTGCCACAGTTAGCAGTCCTGAGAGGAAGCAAATCAAAGTGAACTACATAACAGGAC TGGATTCTTTTGGTGGGCTAAAAGCTCACAACAATGTGAGTTCATTAGGCCTGCCAGTATGCACTGAGCAGTCCTTTGCAAAGGTGGTCAGCTCATTGAG AGCTCCATCAAAGGGTAAAGGCAGAAGTGGGGGTGCACTCTCTTCAACCTGCAGTGATGTTGGTGAGATATTCAGGATAGCAGCAATCATGAATGGGCTT GTTCTTGTTGGAGTTGCAGTGGGATTTGTTCTTCTTCGAGTCGAAGCTTTTGTGGAGGGGACTGAATGA
AA sequence Show only first row Show all	>Potri.009G108700.1 pacid=42772539 polypeptide=Potri.009G108700.1.p locus=Potri.009G108700 ID=Potri.009G108700.1.v4.1 annot-version=v4.1 MATASATLSPATLAAATVSSPERKQIKVNYITGLDSFGGLKAHNNVSSLGLPVCTEQSFAKVVSSLRAPSKGKGRSGGALSSTCSDVGEIFRIAAIMNGL VLVGVAVGFVLLRVEAFVEGTE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G26500			cytochrome b6f complex subunit...		Potri.009G108700 [exp]	0	1
AT3G63088		RTFL14, DVL14	DEVIL 14, ROTUNDIFOLIA like 14...		Potri.014G138900 [exp]	1.00	0.9835
AT1G30380		PSAK	photosystem I subunit K (.1)		Potri.006G254200 [exp]	8.94	0.9469	PSAK.2
AT5G54190		PORA	protochlorophyllide oxidoreduc...		Potri.001G403300 [exp]	10.39	0.9331	PORA.2
AT1G08380		PSAO	photosystem I subunit O (.1)		Potri.009G160800 [exp]	10.53	0.9430
AT1G15820		CP24, LHCB6	light harvesting complex photo...		Potri.001G210000 [exp]	12.80	0.9402	Pt-LHCB6.2,1
AT1G21500			unknown protein		Potri.013G128700 [exp]	13.26	0.9301
AT1G32990		PRPL11	plastid ribosomal protein l11 ...		Potri.011G150700 [exp]	15.81	0.8869
AT4G21780			unknown protein		Potri.011G136500 [exp]	15.81	0.9398
AT5G24460			unknown protein		Potri.010G149800 [exp]	16.43	0.9344
AT2G34430		LHCB1.4, LHB1B1	light-harvesting chlorophyll-p...		Potri.005G239300 [exp]	17.74	0.9338	LHB1.3,Lhcb1-2

Compare expression of checked genes

Potri.009G108700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.