Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G15980 195 / 3e-60 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G63150 92 / 8e-22 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G63130 88 / 3e-20 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G62680 87 / 4e-20 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G62914 87 / 7e-20 pentatricopeptide (PPR) repeat-containing protein (.1) AT1G62670 87 / 9e-20 RPF2 rna processing factor 2 (.1) AT1G63630 84 / 9e-20 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) AT1G62930 86 / 1e-19 RPF3 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G63080 86 / 2e-19 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G63400 86 / 2e-19 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G149400 [exp] 308 / 2e-103 AT2G15980 477 / 4e-165 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.005G014500 [exp] 92 / 2e-21 AT1G09820 696 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.009G105600 [exp] 90 / 6e-21 AT5G39710 1022 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.010G035700 [exp] 89 / 1e-20 AT1G05670 922 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1), Pentatricopeptide repeat (PPR-like) superfamily protein (.2) Potri.004G074500 [exp] 87 / 6e-20 AT1G62930 478 / 1e-162 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.005G050300 [exp] 86 / 1e-19 AT1G12700 466 / 5e-156 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G050240 [exp] 86 / 2e-19 AT1G12700 465 / 1e-155 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G050120 [exp] 84 / 3e-19 AT1G12700 295 / 3e-94 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.001G276500 [exp] 84 / 5e-19 AT5G01110 863 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020712 [exp] 201 / 3e-62 AT2G15980 408 / 4e-138 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10013283 [exp] 88 / 3e-20 AT1G05670 785 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1), Pentatricopeptide repeat (PPR-like) superfamily protein (.2) Lus10039056 [exp] 88 / 4e-20 AT5G64320 832 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10037319 [exp] 84 / 9e-19 AT4G11690 534 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Lus10008593 [exp] 82 / 3e-18 AT1G12700 400 / 7e-131 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10026935 [exp] 77 / 7e-18 AT3G22470 133 / 2e-36 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10002107 [exp] 81 / 1e-17 AT5G02860 1040 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10028943 [exp] 79 / 1e-17 AT5G01110 299 / 2e-97 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10035735 [exp] 80 / 2e-17 AT4G11690 526 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Lus10009548 [exp] 80 / 2e-17 AT4G26680 561 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [poplar] [flax] TPR PF01535 [poplar] [flax] PPR PPR repeat CL0020 [poplar] [flax] TPR PF13041 [poplar] [flax] PPR_2 PPR repeat family
Representative CDS sequence Show only first row Show all	>Potri.009G110400.2 pacid=42770766 polypeptide=Potri.009G110400.2.p locus=Potri.009G110400 ID=Potri.009G110400.2.v4.1 annot-version=v4.1 ATGTTAAGGTCTAAAGGGATCAGCCCATCAATTAGTACTTGTAATACTTTGATATGTGAGGTTTCGAGGGGTAAAGGGTCATTTGCTGGTTATGGGGTTT TTAAGGAGGTTTTCGGATTGGGAAGTTGTGAACTTGAGGGGAAAATGAGAAGGGGTTTTAGAAATACGCCTAATGTACATAGTTTTAATGAATCAGTGGT GGGTTTCTATAAAGATGGTGAAGTGCAGATGGTTGAGGAGATTTGGAGTGAAATGGGCAGATTTGGCTGTGTTGCAAATGGGTTTAGCTTTGGTGTTTTT AATGGCTTTTATTTTTTTTGTGAGGGAGGGAGGTTGAGTGAAGCAGAGAAGTTATGGGAGGAAATGAGAGTGAAAGGAATAGTGCCTGATATTGTTGCTT ATAATACTATTATCGGGGGGTTTTGCAAGGTTGGAGAGGTTGAGAAAGCTGAGGGTCTTTTTAGAGAAATGGGGTTGAGTGGAATTGAGAGTACTTGTGT TACTTTTGAGCATCTTAGTAAGGGGTATTGTAGAATTGGGGGTGTTGATTCGGCTATTCTTGTGTATAAGAATATGTGTAGGAGAGGGCTTTGTTAG
AA sequence Show only first row Show all	>Potri.009G110400.2 pacid=42770766 polypeptide=Potri.009G110400.2.p locus=Potri.009G110400 ID=Potri.009G110400.2.v4.1 annot-version=v4.1 MLRSKGISPSISTCNTLICEVSRGKGSFAGYGVFKEVFGLGSCELEGKMRRGFRNTPNVHSFNESVVGFYKDGEVQMVEEIWSEMGRFGCVANGFSFGVF NGFYFFCEGGRLSEAEKLWEEMRVKGIVPDIVAYNTIIGGFCKVGEVEKAEGLFREMGLSGIESTCVTFEHLSKGYCRIGGVDSAILVYKNMCRRGLC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G15980			Tetratricopeptide repeat (TPR)...		Potri.009G110400 [exp]	0	1
AT1G19290			Pentatricopeptide repeat (PPR)...		Potri.014G040200 [exp]	3.74	0.8756
AT4G20090		EMB1025	embryo defective 1025, Pentatr...		Potri.003G154800 [exp]	6.48	0.8670
AT2G44200			CBF1-interacting co-repressor ...		Potri.016G000501 [exp]	8.36	0.8609
AT1G55325		MAB2, GCT	MACCHI-BOU 2, GRAND CENTRAL, R...		Potri.001G004200 [exp]	11.61	0.8648
AT1G45231			S-adenosyl-L-methionine-depend...		Potri.014G028000 [exp]	12.16	0.8258
AT2G44730	Trihelix		Alcohol dehydrogenase transcri...		Potri.002G139500 [exp]	12.64	0.8555
AT1G32490		EMB2733, ESP3	ENHANCED SILENCING PHENOTYPE 3...		Potri.015G008700 [exp]	15.16	0.8488
AT4G29940	HD	PRHA	pathogenesis related homeodoma...		Potri.006G075500 [exp]	16.30	0.8453
AT2G40770			zinc ion binding;DNA binding;h...		Potri.019G060900 [exp]	16.37	0.8612
AT1G21700		CHB4, ATSWI3C	SWITCH/sucrose nonfermenting 3...		Potri.005G180800 [exp]	17.66	0.8606	CHB904,CHB4.1

Compare expression of checked genes

Potri.009G110400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.