Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G48485 62 / 9e-14 DIR1 DEFECTIVE IN INDUCED RESISTANCE 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G48490 57 / 6e-12 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G55410 49 / 9e-09 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT5G55460 40 / 3e-05 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G07450 39 / 5e-05 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G52130 39 / 0.0001 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.T125404 [exp] 192 / 5e-65 AT5G48485 62 / 1e-13 DEFECTIVE IN INDUCED RESISTANCE 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.014G149900 [exp] 72 / 2e-17 AT5G48485 77 / 1e-19 DEFECTIVE IN INDUCED RESISTANCE 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.002G251000 [exp] 67 / 9e-16 AT5G48485 76 / 2e-19 DEFECTIVE IN INDUCED RESISTANCE 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025866 [exp] 69 / 3e-16 AT5G48490 79 / 3e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10038233 [exp] 69 / 3e-16 AT5G48490 78 / 5e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10002741 [exp] 52 / 6e-10 AT5G48490 74 / 3e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10039511 [exp] 49 / 2e-08 AT5G48485 80 / 4e-21 DEFECTIVE IN INDUCED RESISTANCE 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032575 [exp] 47 / 4e-08 AT5G55410 73 / 2e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10016323 [exp] 45 / 3e-07 AT5G48490 74 / 1e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10016582 [exp] 45 / 4e-07 AT5G55410 81 / 2e-21 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10030541 [exp] 40 / 6e-05 AT3G07450 116 / 3e-35 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [poplar] [flax] Prolamin PF14368 [poplar] [flax] LTP_2 Probable lipid transfer
Representative CDS sequence Show only first row Show all	>Potri.009G112553.1 pacid=42771713 polypeptide=Potri.009G112553.1.p locus=Potri.009G112553 ID=Potri.009G112553.1.v4.1 annot-version=v4.1 ATGGAGGCACGCACAAAGAATTTTGTCGTTGTGGCATTGGTCATGGCCTTCGCCCTGGTGTCCAACCCCATTGCGGCAAAAGGACAGGTCACCTTATGCG GCATGACCAAAGAGGGTTTTGCTTCATGTAAGCCATCAGTGCAGACAGGTGTTAACCCTCTTCCACCATCATATTCATGCTGCTCGGCTTTAGAGAAAGC TGACTTGAGCTGCCTTTGCTTTTTCAAGAAAAACTACCCTAAAATGCTAACTGACAATAATATAGATCCCAACTTGGCAATGCAGCTTCCGGCGAAGTGC AACATGGCGGGGTCTTTCAGTTGCAAATAA
AA sequence Show only first row Show all	>Potri.009G112553.1 pacid=42771713 polypeptide=Potri.009G112553.1.p locus=Potri.009G112553 ID=Potri.009G112553.1.v4.1 annot-version=v4.1 MEARTKNFVVVALVMAFALVSNPIAAKGQVTLCGMTKEGFASCKPSVQTGVNPLPPSYSCCSALEKADLSCLCFFKKNYPKMLTDNNIDPNLAMQLPAKC NMAGSFSCK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G48485		DIR1	DEFECTIVE IN INDUCED RESISTANC...		Potri.009G112553 [exp]	0	1
AT5G42180		PER64	peroxidase 64, Peroxidase supe...		Potri.002G018000 [exp]	3.74	0.7218
AT2G05940		RIPK	RPM1-induced protein kinase, P...		Potri.006G219300 [exp]	14.31	0.6515
AT2G06925		ATSPLA2-ALPHA, ...	PHOSPHOLIPASE A2-ALPHA, Phosph...		Potri.006G070400 [exp]	18.02	0.6053
AT3G02875		ILR1	IAA-LEUCINE RESISTANT 1, Pepti...		Potri.016G074100 [exp]	24.69	0.6206
AT1G78950		ATLUP3	Terpenoid cyclases family prot...		Potri.014G002400 [exp]	42.74	0.5751
AT5G65640	bHLH	bHLH093	beta HLH protein 93 (.1.2)		Potri.002G108400 [exp]	56.74	0.5605
AT4G23740			Leucine-rich repeat protein ki...		Potri.012G033200 [exp]	73.19	0.5967
AT1G79720			Eukaryotic aspartyl protease f...		Potri.003G185175 [exp]	79.14	0.5802
AT2G25790			Leucine-rich receptor-like pro...		Potri.006G237400 [exp]	93.43	0.5747
AT1G03220			Eukaryotic aspartyl protease f...		Potri.005G095600 [exp]	99.91	0.5789

Compare expression of checked genes

Potri.009G112553 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.