Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G36720 241 / 1e-81 HVA22K HVA22-like protein K (.1) AT1G69700 75 / 7e-17 ATHVA22C HVA22 homologue C (.1) AT1G75700 73 / 4e-16 HVA22G HVA22-like protein G (.1) AT5G62490 72 / 4e-16 ATHVA22B ARABIDOPSIS THALIANA HVA22 HOMOLOGUE B, HVA22 homologue B (.1) AT5G42560 72 / 4e-15 Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.1), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.2), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.3) AT2G36020 70 / 1e-14 HVA22J HVA22-like protein J (.1) AT1G19950 70 / 3e-14 HVA22H HVA22-like protein H (ATHVA22H) (.1) AT2G42820 67 / 4e-14 HVA22F HVA22-like protein F (.1) AT1G74520 65 / 2e-13 ATHVA22A HVA22 homologue A (.1) AT4G24960 64 / 4e-13 ATHVA22D ARABIDOPSIS THALIANA HVA22 HOMOLOGUE D, HVA22 homologue D (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G029300 [exp] 249 / 8e-85 AT4G36720 252 / 2e-85 HVA22-like protein K (.1) Potri.005G237900 [exp] 75 / 3e-16 AT5G42560 274 / 1e-91 Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.1), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.2), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.3) Potri.016G072600 [exp] 72 / 9e-16 AT2G36020 210 / 9e-69 HVA22-like protein J (.1) Potri.002G023500 [exp] 72 / 3e-15 AT5G42560 296 / 2e-100 Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.1), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.2), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.3) Potri.012G069300 [exp] 70 / 4e-15 AT1G74520 259 / 1e-89 HVA22 homologue A (.1) Potri.001G006000 [exp] 69 / 5e-15 AT2G42820 235 / 1e-80 HVA22-like protein F (.1) Potri.015G062800 [exp] 68 / 2e-14 AT1G74520 255 / 4e-88 HVA22 homologue A (.1) Potri.006G205300 [exp] 69 / 3e-14 AT2G36020 228 / 1e-74 HVA22-like protein J (.1) Potri.004G166800 [exp] 64 / 1e-12 AT1G75700 234 / 3e-78 HVA22-like protein G (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010093 [exp] 239 / 3e-81 AT4G36720 202 / 2e-66 HVA22-like protein K (.1) Lus10007215 [exp] 228 / 4e-77 AT4G36720 196 / 2e-64 HVA22-like protein K (.1) Lus10024234 [exp] 77 / 2e-17 AT1G74520 244 / 5e-83 HVA22 homologue A (.1) Lus10023605 [exp] 77 / 2e-17 AT1G74520 246 / 7e-84 HVA22 homologue A (.1) Lus10034519 [exp] 74 / 5e-16 AT5G42560 324 / 2e-111 Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.1), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.2), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.3) Lus10033152 [exp] 74 / 5e-16 AT5G42560 328 / 7e-113 Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.1), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.2), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.3) Lus10024332 [exp] 74 / 9e-16 AT5G42560 330 / 9e-114 Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.1), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.2), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.3) Lus10010944 [exp] 71 / 2e-15 AT2G42820 246 / 7e-85 HVA22-like protein F (.1) Lus10031386 [exp] 71 / 2e-15 AT2G42820 246 / 4e-85 HVA22-like protein F (.1) Lus10042193 [exp] 73 / 5e-15 AT5G39850 327 / 2e-108 Ribosomal protein S4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03134 [poplar] [flax] TB2_DP1_HVA22 TB2/DP1, HVA22 family
Representative CDS sequence Show only first row Show all	>Potri.009G113400.1 pacid=42770968 polypeptide=Potri.009G113400.1.p locus=Potri.009G113400 ID=Potri.009G113400.1.v4.1 annot-version=v4.1 ATGGCGTTTCCAGGAGAGGTGGGATTGCAATTGCTTCTTTCACCACTGAATTCCAACATTGTTGTCCGGACAGCTTGCTGTTCTGTTGGAATTGCTTTAC CTATTTACTCAACATTTAAGGCTATTGAAAATAAAGATCAAATCGAGCAACAGCGATGGCTTCTCTACTGGGCTGCTTATGGATCTTTTAGCCTCGCGGA AGTCTTTGCAGATAAAATTCTCTCCTGGTTTCCCCTTTACTATCACATGAAGTTTGCATTTCTTGTTTGGCTACAGCTCCCATCTGCAAATGGAGCTGGG CAATTGTATATGAGCCATCTACGCCCATTCCTGTTGAGGCATCAAGCCAGACTTGATAATTTTGTGGAGTTTCTGTATGGTGAAATGAATAAGTTTGTCA GTGCACATCAAGCTGAATTTCGGTTTGCAAAAGCACTTTTAATGAAGATTCTGGCATCAGTGAACCAAATAGCTCGTGATGTGATTCGCCCAGGGGGAAG ACAGGCAAATGGCACCTTTCAAGGCCCAGCCAGGCGAATCCAGGATTCACAATCTGACGGGGAAGATTAG
AA sequence Show only first row Show all	>Potri.009G113400.1 pacid=42770968 polypeptide=Potri.009G113400.1.p locus=Potri.009G113400 ID=Potri.009G113400.1.v4.1 annot-version=v4.1 MAFPGEVGLQLLLSPLNSNIVVRTACCSVGIALPIYSTFKAIENKDQIEQQRWLLYWAAYGSFSLAEVFADKILSWFPLYYHMKFAFLVWLQLPSANGAG QLYMSHLRPFLLRHQARLDNFVEFLYGEMNKFVSAHQAEFRFAKALLMKILASVNQIARDVIRPGGRQANGTFQGPARRIQDSQSDGED

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G36720		HVA22K	HVA22-like protein K (.1)		Potri.009G113400 [exp]	0	1
AT3G48330		ATPIMT1, PIMT1	Arabidopsis thaliana protein-l...		Potri.015G086600 [exp]	2.44	0.7625
AT5G17610			unknown protein		Potri.013G073100 [exp]	3.46	0.8181
AT1G25682			Family of unknown function (DU...		Potri.010G130300 [exp]	10.39	0.6673
AT3G11530			Vacuolar protein sorting 55 (V...		Potri.006G209100 [exp]	10.39	0.7196
AT4G20380		LSD1	LESION SIMULATING DISEASE, LSD...		Potri.001G442400 [exp]	10.95	0.7709	LSD1.1
AT3G24730			mRNA splicing factor, thioredo...		Potri.001G287600 [exp]	11.87	0.6568
AT1G54210		ATATG12, APG12,...	AUTOPHAGY 12 A, AUTOPHAGY 12, ...		Potri.001G169700 [exp]	13.26	0.7214
AT2G05630		ATG8D	Ubiquitin-like superfamily pro...		Potri.014G153800 [exp]	14.42	0.7194
AT3G51130			unknown protein		Potri.005G117200 [exp]	18.57	0.7165
AT1G19690			NAD(P)-binding Rossmann-fold s...		Potri.002G031500 [exp]	18.97	0.6739

Compare expression of checked genes

Potri.009G113400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.