Plant FIBer expression Database

Potri.009G113550 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.009G113550.1 pacid=42772194 polypeptide=Potri.009G113550.1.p locus=Potri.009G113550 ID=Potri.009G113550.1.v4.1 annot-version=v4.1
ATGTGCCTCTGGAAGACTGGAACTTACAGAATTGCTCTCTTGCTTTATTATTTCAAGTTGGGTACAATAATGGGCGTTCTCTCCATGTGCCTCGTTGTGG
GGCTTGGAAAGGGACGTCCCGGTAGAAAGCTTGCCTTTTCCACCATCAAGGGGTGGTCAGTTTTACCAGATAGAGATAGAATAGGCCGCCTAAGTCTCTG
TCTTTTCATAGACTACAAGAATTTTATTTCCCTAGAAATGAATTACAAAATCCCACAACCTCACAAAGCTCCACCACCCCTTTCCTTTTGCAACGTGATA
CTGATCTCTCGCCTGCTAAAGTCCATCGCCGTTGTCTTTTCTATTCAGCTACCACTCCCAGTTTTTATTTCCCATGTTGGTTAG
AA sequence
>Potri.009G113550.1 pacid=42772194 polypeptide=Potri.009G113550.1.p locus=Potri.009G113550 ID=Potri.009G113550.1.v4.1 annot-version=v4.1
MCLWKTGTYRIALLLYYFKLGTIMGVLSMCLVVGLGKGRPGRKLAFSTIKGWSVLPDRDRIGRLSLCLFIDYKNFISLEMNYKIPQPHKAPPPLSFCNVI
LISRLLKSIAVVFSIQLPLPVFISHVG

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.009G113550
[exp]
0 1
AT5G50760 SAUR-like auxin-responsive pro... Potri.003G167400
[exp]
1.41 0.8512 SAUR1
AT5G60800 Heavy metal transport/detoxifi... Potri.009G007600
[exp]
10.58 0.8160
AT1G70560 CKRC1, WEI8, TA... WEAK ETHYLENE INSENSITIVE 8, S... Potri.008G187800
[exp]
13.85 0.7663
AT5G36110 CYP716A1 "cytochrome P450, family 716, ... Potri.018G149300
[exp]
13.92 0.8502 CYP716.1
AT2G41180 SIB2 sigma factor binding protein 2... Potri.019G013300
[exp]
15.49 0.8498
AT5G07610 F-box family protein (.1) Potri.013G109900
[exp]
16.37 0.7769
AT1G61660 bHLH bHLH112 basic helix-loop-helix (bHLH) ... Potri.004G029100
[exp]
16.73 0.8222
AT3G57120 Protein kinase superfamily pro... Potri.008G037401
[exp]
16.91 0.8083
AT2G27480 Calcium-binding EF-hand family... Potri.009G163600
[exp]
21.90 0.8067
AT5G48230 EMB1276, ACAT2 EMBRYO DEFECTIVE 1276, acetoac... Potri.014G168700
[exp]
23.32 0.8145

Potri.009G113550 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.