Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-ACT2.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G18820 408 / 2e-147 RAB71, AtRABG3f, AtRab7B RAB GTPase homolog G3F (.1) AT1G49300 395 / 2e-142 ATRAB7, ATRABG3E ARABIDOPSIS RAB GTPASE HOMOLOG G3E, ARABIDOPSIS RAB GTPASE HOMOLOG 7, RAB GTPase homolog G3E (.1.2) AT1G52280 376 / 8e-135 AtRABG3d RAB GTPase homolog G3D (.1) AT3G16100 375 / 1e-134 AtRABG3c, AtRab7D RAB GTPase homolog G3C (.1) AT4G09720 318 / 4e-112 AtRABG3a RAB GTPase homolog G3A (.1.2.3.4) AT1G22740 312 / 2e-109 RAB75, RAB7, AtRABG3b RAB GTPase homolog G3B (.1) AT2G21880 279 / 2e-96 AtRab7A, AtRABG2 ARABIDOPSIS RAB GTPASE HOMOLOG G2, RAB GTPase homolog 7A (.1.2) AT5G39620 218 / 3e-72 AtRABG1 RAB GTPase homolog G1 (.1) AT1G28550 137 / 1e-40 AtRABA1i RAB GTPase homolog A1I (.1) AT2G33870 137 / 1e-40 ArRABA1h RAB GTPase homolog A1H (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G153400 [exp] 424 / 7e-154 AT3G18820 405 / 2e-146 RAB GTPase homolog G3F (.1) Potri.003G053400 [exp] 364 / 4e-130 AT1G52280 395 / 2e-142 RAB GTPase homolog G3D (.1) Potri.001G182900 [exp] 360 / 2e-128 AT3G16100 394 / 7e-142 RAB GTPase homolog G3C (.1) Potri.002G062400 [exp] 323 / 6e-114 AT4G09720 375 / 1e-134 RAB GTPase homolog G3A (.1.2.3.4) Potri.005G198800 [exp] 312 / 2e-109 AT4G09720 370 / 2e-132 RAB GTPase homolog G3A (.1.2.3.4) Potri.005G085300 [exp] 289 / 3e-100 AT4G09720 291 / 3e-101 RAB GTPase homolog G3A (.1.2.3.4) Potri.007G079700 [exp] 236 / 8e-80 AT4G09720 272 / 3e-94 RAB GTPase homolog G3A (.1.2.3.4) Potri.001G080400 [exp] 139 / 2e-41 AT1G02130 387 / 2e-139 ARABIDOPSIS THALIANA RAB D2A, ARABIDOPSIS THALIANA RESPONSIVE TO ABSCISIC ACID 1B, ARABIDOPSIS RAS 5, RAS 5 (.1) Potri.003G086700 [exp] 136 / 4e-40 AT2G44610 397 / 4e-143 Ras-related small GTP-binding family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040468 [exp] 416 / 2e-150 AT3G18820 403 / 2e-145 RAB GTPase homolog G3F (.1) Lus10035872 [exp] 384 / 5e-138 AT1G52280 397 / 4e-143 RAB GTPase homolog G3D (.1) Lus10042328 [exp] 382 / 4e-137 AT3G18820 367 / 3e-131 RAB GTPase homolog G3F (.1) Lus10023582 [exp] 340 / 5e-121 AT3G18820 330 / 4e-117 RAB GTPase homolog G3F (.1) Lus10028719 [exp] 295 / 5e-103 AT4G09720 341 / 5e-121 RAB GTPase homolog G3A (.1.2.3.4) Lus10006059 [exp] 281 / 1e-97 AT4G09720 323 / 4e-114 RAB GTPase homolog G3A (.1.2.3.4) Lus10025790 [exp] 243 / 3e-82 AT1G52280 257 / 5e-88 RAB GTPase homolog G3D (.1) Lus10005443 [exp] 134 / 3e-39 AT3G46060 394 / 2e-141 RAB GTPase homolog 8A (.1.2.3) Lus10002178 [exp] 133 / 5e-39 AT5G60860 423 / 4e-153 RAB GTPase homolog A1F (.1) Lus10019501 [exp] 133 / 7e-39 AT2G44610 407 / 5e-147 Ras-related small GTP-binding family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF00025 [poplar] [flax] Arf ADP-ribosylation factor family
Representative CDS sequence Show only first row Show all	>Potri.009G115000.1 pacid=42771365 polypeptide=Potri.009G115000.1.p locus=Potri.009G115000 ID=Potri.009G115000.1.v4.1 annot-version=v4.1 ATGCCTTCCCGTAGAAGAACTCTCTTGAAGGTCATCATCCTCGGAGACAGCGGGGTAGGAAAGACCTCTTTGATGAATCAATATGTAAACAAGAAGTTTA GCAATCAATACAAGGCGACAATTGGAGCTGATTTCTTGACTAAGGAAGTTCAGTTTGAAGATAGGCTCTTCACTTTACAGATCTGGGATACTGCTGGGCA GGAAAGATTCCAAAGCCTCGGTGTTGCTTTCTATCGTGGTGCTGATTGTTGTGTTCTTGTATATGATGTCAATTCGATGAAATCTTTTGATAACCTTAAT AATTGGAGGGAAGAATTCCTCATTCAGGCAAGCCCTTCAGACCCAGAGAATTTCCCATTTGTTGTTCTTGGAAACAAGGTCGACGTGGATGGTGGAAATA GCAGAGTGGTTTCAGAGAAAAAGGCACGGGCATGGTGTGCCTCGAAAGGGAATATCCCTTACTTTGAAACCTCTGCCAAGGAAGGCATTAATGTTGAGGA AGCTTTCCAATGCATAGCAAAGAATGCCCTGAAGAGTGGGGAAGAGGAAGAGATATACTTGCCAGATACCATTGATGTTGGAACTAGTAGTCAACCTAGG TCAACTGGATGTGAGTGCTAA
AA sequence Show only first row Show all	>Potri.009G115000.1 pacid=42771365 polypeptide=Potri.009G115000.1.p locus=Potri.009G115000 ID=Potri.009G115000.1.v4.1 annot-version=v4.1 MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQIWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLN NWREEFLIQASPSDPENFPFVVLGNKVDVDGGNSRVVSEKKARAWCASKGNIPYFETSAKEGINVEEAFQCIAKNALKSGEEEEIYLPDTIDVGTSSQPR STGCEC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G18820		RAB71, AtRABG3f...	RAB GTPase homolog G3F (.1)		Potri.009G115000 [exp]	0	1	Pt-ACT2.1
AT4G09720		AtRABG3a	RAB GTPase homolog G3A (.1.2.3...		Potri.005G198800 [exp]	1.41	0.8309	RAB7.1
AT3G01280		VDAC1, ATVDAC1	ARABIDOPSIS THALIANA VOLTAGE D...		Potri.010G033500 [exp]	2.44	0.7836	POR1.2
AT4G38800		ATMTN1, ATMTAN1	ARABIDOPSIS METHYLTHIOADENOSIN...		Potri.004G167200 [exp]	4.00	0.7686
AT4G02450			HSP20-like chaperones superfam...		Potri.002G061500 [exp]	8.77	0.7364
AT2G32520			alpha/beta-Hydrolases superfam...		Potri.014G155200 [exp]	8.94	0.7335
AT5G20165			unknown protein		Potri.008G176801 [exp]	10.67	0.7751
AT1G08830		CSD1	copper/zinc superoxide dismuta...		Potri.013G031100 [exp]	10.90	0.7085	CUZN-SOD.2
AT5G55290			ATPase, V0 complex, subunit E ...		Potri.001G359600 [exp]	10.95	0.7471
AT3G27090			DCD (Development and Cell Deat...		Potri.001G330300 [exp]	11.95	0.7199
AT1G28510			Optic atrophy 3 protein (OPA3)...		Potri.011G059800 [exp]	16.58	0.6943

Compare expression of checked genes

Potri.009G115000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.