Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	RD2.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G21620 259 / 2e-89 RD2 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT3G58450 58 / 1e-10 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT3G11930 56 / 1e-09 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) AT3G53990 53 / 4e-09 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT3G62550 49 / 2e-07 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT5G14680 49 / 2e-07 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT1G68300 48 / 4e-07 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT1G11360 44 / 1e-05 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) AT2G47710 43 / 2e-05 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G03270 42 / 3e-05 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G156200 [exp] 286 / 4e-100 AT2G21620 256 / 3e-88 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.004G156100 [exp] 245 / 1e-83 AT2G21620 241 / 6e-82 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.006G092700 [exp] 63 / 7e-13 AT3G53990 207 / 1e-69 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.016G064000 [exp] 59 / 5e-11 AT3G11930 214 / 4e-71 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Potri.006G198200 [exp] 59 / 8e-11 AT3G11930 209 / 9e-69 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Potri.014G122000 [exp] 54 / 2e-09 AT3G62550 195 / 1e-64 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.016G104600 [exp] 54 / 3e-09 AT3G53990 229 / 6e-78 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.005G015200 [exp] 52 / 1e-08 AT3G62550 156 / 4e-49 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.002G196700 [exp] 52 / 1e-08 AT3G62550 196 / 6e-65 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042316 [exp] 262 / 1e-90 AT2G21620 284 / 3e-99 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10026346 [exp] 248 / 5e-82 AT2G21620 269 / 5e-90 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10042317 [exp] 176 / 5e-56 AT2G21620 177 / 2e-56 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10021501 [exp] 52 / 1e-08 AT3G53990 144 / 3e-45 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10021104 [exp] 51 / 3e-08 AT3G53990 215 / 2e-72 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10022602 [exp] 50 / 8e-08 AT3G53990 225 / 2e-76 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10031594 [exp] 51 / 9e-08 AT1G11360 257 / 2e-86 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Lus10039730 [exp] 50 / 2e-07 AT1G11360 288 / 3e-98 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Lus10032142 [exp] 47 / 1e-06 AT5G14680 296 / 3e-104 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10014545 [exp] 47 / 1e-06 AT5G14680 295 / 6e-104 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0039 [poplar] [flax] HUP PF00582 [poplar] [flax] Usp Universal stress protein family
Representative CDS sequence Show only first row Show all	>Potri.009G117500.2 pacid=42772063 polypeptide=Potri.009G117500.2.p locus=Potri.009G117500 ID=Potri.009G117500.2.v4.1 annot-version=v4.1 ATGGAGGTACTGGAAGAAGATGAAGAGTACAACTGGAGAGAAGTGAGACTGCCTTCAATGACACGAATAGAACCCGAACCAGAGCTTGAAAGAGAGAAAG GGGAAAGAAGAAGAGGCAGAGACATACTTATAGCGATTGATCATGGGCCAAATAGCAAGCATGCTTTTGATTGGGCTTTGATTCACCTCTGCAGGCTGGC TGACACCATCCATCTTGTCCATGCTGTCTCTAGTGTGCAAAATACTGTTGTTTACGAGACAAGCCAGCAGCTCTTGGAGAAGCTTGCTGTGGAGGCTTTG CAGGTTGCCATGGTGAGTACTGTGGCTCGGATTGTGGAAGGGGATGCTGGTAAGATAATTTGCAAGGAAGCAGTAAGGCTAAAGCCTGCAGCAGTGGTGA TGGGTACCAGAGGCAGAGGCTTAGTTCAAAGTTTTCTTCAGGGTAGTGCGAGTGAATATTGCTTTCACCACTGTAAAGTAGCACCTGTTATAATTGTTCC TGGGAAAGAAGCTGGAGATGAATCATTGATATAA
AA sequence Show only first row Show all	>Potri.009G117500.2 pacid=42772063 polypeptide=Potri.009G117500.2.p locus=Potri.009G117500 ID=Potri.009G117500.2.v4.1 annot-version=v4.1 MEVLEEDEEYNWREVRLPSMTRIEPEPELEREKGERRRGRDILIAIDHGPNSKHAFDWALIHLCRLADTIHLVHAVSSVQNTVVYETSQQLLEKLAVEAL QVAMVSTVARIVEGDAGKIICKEAVRLKPAAVVMGTRGRGLVQSFLQGSASEYCFHHCKVAPVIIVPGKEAGDESLI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G21620		RD2	Adenine nucleotide alpha hydro...		Potri.009G117500 [exp]	0	1	RD2.1
AT4G31750		WIN2	HOPW1-1-interacting 2 (.1)		Potri.018G013900 [exp]	2.82	0.9006
AT2G30080		ATZIP6, ZIP6	ZIP metal ion transporter fami...		Potri.001G279300 [exp]	14.49	0.8263	ZIP6.3
AT3G51730			saposin B domain-containing pr...		Potri.016G133400 [exp]	18.57	0.8311
AT5G04250			Cysteine proteinases superfami...		Potri.008G036900 [exp]	23.36	0.8581
AT1G29800			RING/FYVE/PHD-type zinc finger...		Potri.004G062500 [exp]	24.18	0.8197
AT5G14040		PHT3;1	phosphate transporter 3;1 (.1)		Potri.015G104400 [exp]	29.64	0.8669
AT1G80570			RNI-like superfamily protein (...		Potri.017G053400 [exp]	31.43	0.8037
AT5G47860			Protein of unknown function (D...		Potri.003G158400 [exp]	40.62	0.8451
AT5G61920			unknown protein		Potri.006G178100 [exp]	47.02	0.7771
AT5G57900		SKIP1	SKP1 interacting partner 1 (.1...		Potri.018G104900 [exp]	47.90	0.7837	Pt-SKIP1.1

Compare expression of checked genes

Potri.009G117500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.