Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G39200 135 / 1e-42 Ribosomal protein S25 family protein (.1.2) AT2G21580 134 / 3e-42 Ribosomal protein S25 family protein (.1.2) AT4G34555 133 / 8e-42 Ribosomal protein S25 family protein (.1) AT2G16360 126 / 5e-39 Ribosomal protein S25 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G157200 [exp] 149 / 3e-48 AT4G39200 135 / 1e-42 Ribosomal protein S25 family protein (.1.2) Potri.010G239300 [exp] 144 / 4e-46 AT4G39200 131 / 6e-41 Ribosomal protein S25 family protein (.1.2) Potri.008G020000 [exp] 143 / 1e-45 AT4G34555 132 / 2e-41 Ribosomal protein S25 family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034277 [exp] 135 / 1e-42 AT2G21580 157 / 3e-51 Ribosomal protein S25 family protein (.1.2) Lus10021706 [exp] 134 / 3e-42 AT4G39200 161 / 7e-53 Ribosomal protein S25 family protein (.1.2) Lus10035060 [exp] 134 / 3e-42 AT4G39200 161 / 7e-53 Ribosomal protein S25 family protein (.1.2) Lus10023552 [exp] 130 / 1e-40 AT4G39200 169 / 7e-56 Ribosomal protein S25 family protein (.1.2) Lus10040436 [exp] 122 / 4e-38 AT4G39200 130 / 3e-41 Ribosomal protein S25 family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0123 [poplar] [flax] HTH PF03297 [poplar] [flax] Ribosomal_S25 S25 ribosomal protein
Representative CDS sequence Show only first row Show all	>Potri.009G118900.5 pacid=42770916 polypeptide=Potri.009G118900.5.p locus=Potri.009G118900 ID=Potri.009G118900.5.v4.1 annot-version=v4.1 ATGGCACCGAAGAAGGAGAAGGCGCCGCCACCGTCATCAAAGCCAGCGAAATCAGGAGGAGGGAAGCAGAAGAAGAAGAAGTGGAGCAAGGGAAAGCAAA AGGAGAAAGTCAACAACATGGTTCTCTTTGATCAAGCTACTTATGATAAGCTTCTCTCCGAAGCTCCTAAGTACAAGCTTATCACTCCTTCTGTCCTCTC CGATCGTATGAGGATTAGTGGATCACTTGCAAGGAAGGCAATCAGGGAACTGATGGCTAGAGGTTCAATTAGGATGGTCTCTTCCCATGCAAGCCAGCAG ATTTACACCAGGGCAACCAACACCTAG
AA sequence Show only first row Show all	>Potri.009G118900.5 pacid=42770916 polypeptide=Potri.009G118900.5.p locus=Potri.009G118900 ID=Potri.009G118900.5.v4.1 annot-version=v4.1 MAPKKEKAPPPSSKPAKSGGGKQKKKKWSKGKQKEKVNNMVLFDQATYDKLLSEAPKYKLITPSVLSDRMRISGSLARKAIRELMARGSIRMVSSHASQQ IYTRATNT

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G39200			Ribosomal protein S25 family p...		Potri.009G118900 [exp]	0	1
AT5G27700			Ribosomal protein S21e (.1)		Potri.005G026000 [exp]	2.82	0.9622
AT4G10450			Ribosomal protein L6 family (....		Potri.011G147700 [exp]	5.65	0.9523	Pt-RPL9.4
AT3G59540			Ribosomal L38e protein family ...		Potri.017G026000 [exp]	7.07	0.9235
AT5G61170			Ribosomal protein S19e family ...		Potri.004G118800 [exp]	8.12	0.9411	RPS19.1
AT5G62300			Ribosomal protein S10p/S20e fa...		Potri.012G128300 [exp]	8.71	0.9462	Pt-RPS20.1
AT2G42740		RPL16A	ribosomal protein large subuni...		Potri.011G069200 [exp]	9.16	0.9465	L16.2
AT1G33140		PGY2	PIGGYBACK2, Ribosomal protein ...		Potri.011G148700 [exp]	12.48	0.9324	RPL9.5
AT1G70600			Ribosomal protein L18e/L15 sup...		Potri.006G202300 [exp]	13.49	0.9388	Pt-RPL27.4
AT2G44620		MTACP1, MTACP-1	mitochondrial acyl carrier pro...		Potri.002G135600 [exp]	15.19	0.9148
AT5G02960			Ribosomal protein S12/S23 fami...		Potri.008G044400 [exp]	15.55	0.9268	Pt-RPS23.3

Compare expression of checked genes

Potri.009G118900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.