Potri.009G124700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G21290 45 / 1e-07 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G163100 69 / 6e-17 AT2G21290 41 / 6e-06 unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018053 44 / 5e-07 AT2G21290 100 / 3e-29 unknown protein
Lus10042050 37 / 0.0006 AT5G17990 501 / 6e-176 PHOSPHORIBOSYLANTHRANILATE TRANSFERASE 1, tryptophan biosynthesis 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF17067 RPS31 Ribosomal protein S31e
Representative CDS sequence
>Potri.009G124700.2 pacid=42772379 polypeptide=Potri.009G124700.2.p locus=Potri.009G124700 ID=Potri.009G124700.2.v4.1 annot-version=v4.1
ATGGCGACGGTGATGCAGTGGTGCGGCGCAGTAGCGAGGAGGGCGATGGCGGGTCAGAGATCAGCGGTATTTTCAACATCATCAATATCAAGTGGTGCAG
AGATGGCGCCGATCCTTTGTGGAAGAGGGGACAAGAAAACGAAGAGAGGGAAGAGATTTAAAGGAACTTATGGAAACGCGAGGCCAAAGAAGGAAAAGAA
GATTGAAAGAATTAAAGATAAAGTTGAGGTGCCCAGGTCCACTCCTTGGCCTCTCCCTTTCAAGCTCATTTAA
AA sequence
>Potri.009G124700.2 pacid=42772379 polypeptide=Potri.009G124700.2.p locus=Potri.009G124700 ID=Potri.009G124700.2.v4.1 annot-version=v4.1
MATVMQWCGAVARRAMAGQRSAVFSTSSISSGAEMAPILCGRGDKKTKRGKRFKGTYGNARPKKEKKIERIKDKVEVPRSTPWPLPFKLI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G21290 unknown protein Potri.009G124700 0 1
AT3G08990 Yippee family putative zinc-bi... Potri.006G015500 1.41 0.8368
AT3G24100 Uncharacterised protein family... Potri.001G315400 1.41 0.8456
AT1G26550 FKBP-like peptidyl-prolyl cis-... Potri.008G089900 6.24 0.8344
AT2G17265 DMR1, HSK DOWNY MILDEW RESISTANT 1, homo... Potri.004G207000 7.74 0.8218 HSK.1
AT1G27970 NTF2B nuclear transport factor 2B (.... Potri.003G170800 11.22 0.7435 Pt-NTF2.1
AT5G24400 PGL3, EMB2024 6-PHOSPHOGLUCONOLACTONASE 3, E... Potri.012G024400 14.89 0.7120
AT5G40500 unknown protein Potri.001G344700 16.73 0.6874
AT2G21290 unknown protein Potri.004G163100 17.54 0.7859
AT3G59600 NRPE8B, NRPD8B,... RNA polymerase Rpb8 (.1) Potri.013G120500 19.89 0.7188 Pt-ATRPABC16.2
AT2G45860 unknown protein Potri.014G082300 21.35 0.7579

Potri.009G124700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.