Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G21210 103 / 2e-30 SAUR-like auxin-responsive protein family (.1) AT4G38840 98 / 3e-28 SAUR-like auxin-responsive protein family (.1) AT4G34770 96 / 2e-27 SAUR-like auxin-responsive protein family (.1) AT4G34800 95 / 6e-27 SAUR-like auxin-responsive protein family (.1) AT4G34810 94 / 2e-26 SAUR-like auxin-responsive protein family (.1) AT5G18020 93 / 2e-26 SAUR-like auxin-responsive protein family (.1) AT5G18010 92 / 8e-26 SAUR19, SAUR24 small auxin up RNA 19, SAUR-like auxin-responsive protein family (.1) AT5G18080 91 / 9e-26 SAUR24 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1) AT5G18030 91 / 1e-25 SAUR-like auxin-responsive protein family (.1) AT2G21200 90 / 2e-25 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G165900 [exp] 152 / 7e-50 AT4G34770 99 / 9e-29 SAUR-like auxin-responsive protein family (.1) Potri.004G165600 [exp] 121 / 1e-37 AT4G34770 118 / 4e-36 SAUR-like auxin-responsive protein family (.1) Potri.004G164700 [exp] 108 / 1e-32 AT5G18020 122 / 8e-38 SAUR-like auxin-responsive protein family (.1) Potri.009G127700 [exp] 101 / 1e-29 AT5G18080 114 / 1e-34 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1) Potri.009G126500 [exp] 100 / 2e-29 AT5G18020 124 / 1e-38 SAUR-like auxin-responsive protein family (.1) Potri.009G127600 [exp] 101 / 3e-29 AT5G18080 116 / 7e-35 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1) Potri.009G126700 [exp] 98 / 2e-28 AT4G38840 126 / 3e-39 SAUR-like auxin-responsive protein family (.1) Potri.004G165200 [exp] 97 / 5e-28 AT5G18020 122 / 6e-38 SAUR-like auxin-responsive protein family (.1) Potri.009G127500 [exp] 97 / 5e-28 AT2G21210 128 / 5e-40 SAUR-like auxin-responsive protein family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007561 [exp] 96 / 4e-27 AT4G34810 125 / 1e-38 SAUR-like auxin-responsive protein family (.1) Lus10012184 [exp] 94 / 1e-26 AT4G34810 125 / 9e-39 SAUR-like auxin-responsive protein family (.1) Lus10034511 [exp] 94 / 2e-26 AT1G75580 161 / 9e-53 SAUR-like auxin-responsive protein family (.1) Lus10026294 [exp] 93 / 4e-26 AT4G34810 124 / 3e-38 SAUR-like auxin-responsive protein family (.1) Lus10008999 [exp] 92 / 9e-26 AT4G38840 117 / 7e-36 SAUR-like auxin-responsive protein family (.1) Lus10029198 [exp] 92 / 1e-25 AT4G38840 119 / 2e-36 SAUR-like auxin-responsive protein family (.1) Lus10042378 [exp] 92 / 1e-25 AT4G34810 129 / 3e-40 SAUR-like auxin-responsive protein family (.1) Lus10007560 [exp] 92 / 1e-25 AT4G34770 139 / 3e-44 SAUR-like auxin-responsive protein family (.1) Lus10027317 [exp] 91 / 1e-25 AT5G18030 119 / 1e-36 SAUR-like auxin-responsive protein family (.1) Lus10038191 [exp] 91 / 2e-25 AT4G38840 116 / 2e-35 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [poplar] [flax] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Potri.009G127300.1 pacid=42772211 polypeptide=Potri.009G127300.1.p locus=Potri.009G127300 ID=Potri.009G127300.1.v4.1 annot-version=v4.1 ATGGGTATCCGTTTGTTCAATGCTAAGCAGGTTGTGAGGCGTATTCTTTTGTCTGGAGAAGAAAGCAGTAATGTGCCAAAAGGCCATTTTGTTGTGTATG TTGGAGAAACTCAAAAGAGATGTGTTGTTCCCATCTCCTACTTGAAGAACCCTTCATTTCAGAAGTTGCTTAGACATGTTGAAGAAGAGTATGGCTTTAA CCATCCCATGGGAGGTCTCACCATCCCATGCAGTGAGCAAGTCTTCCATGATCTGATTTGTTGTAGCTCGTAG
AA sequence Show only first row Show all	>Potri.009G127300.1 pacid=42772211 polypeptide=Potri.009G127300.1.p locus=Potri.009G127300 ID=Potri.009G127300.1.v4.1 annot-version=v4.1 MGIRLFNAKQVVRRILLSGEESSNVPKGHFVVYVGETQKRCVVPISYLKNPSFQKLLRHVEEEYGFNHPMGGLTIPCSEQVFHDLICCSS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G21210			SAUR-like auxin-responsive pro...		Potri.009G127300 [exp]	0	1
AT5G44680			DNA glycosylase superfamily pr...		Potri.008G081000 [exp]	8.94	0.6023
					Potri.017G082950 [exp]	16.61	0.5662
AT4G02390		ATPARP1, APP	POLY\(ADP-RIBOSE\) POLYMERASE ...		Potri.009G136501 [exp]	19.49	0.5702
					Potri.018G054600 [exp]	19.97	0.5245
AT5G26330			Cupredoxin superfamily protein...		Potri.002G052500 [exp]	30.39	0.5125
AT3G04280		ARR22	response regulator 22 (.1.2.3)		Potri.003G177400 [exp]	38.96	0.5223
AT1G64160			Disease resistance-responsive ...		Potri.001G096440 [exp]	46.47	0.5019
					Potri.015G009450 [exp]	50.49	0.4949
AT4G14750		IQD19	IQ-domain 19 (.1)		Potri.008G156700 [exp]	72.66	0.5128
AT1G50200		ACD, ALATS	Alanyl-tRNA synthetase (.1.2)		Potri.007G070250 [exp]	82.75	0.4867

Compare expression of checked genes

Potri.009G127300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.