Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G32090 117 / 6e-35 Beta-1,3-N-Acetylglucosaminyltransferase family protein (.1) AT4G32080 107 / 3e-31 unknown protein AT4G32105 77 / 3e-19 Beta-1,3-N-Acetylglucosaminyltransferase family protein (.1) AT4G32110 74 / 4e-18 Beta-1,3-N-Acetylglucosaminyltransferase family protein (.1) AT4G32100 72 / 3e-17 Beta-1,3-N-Acetylglucosaminyltransferase family protein (.1) AT1G32583 42 / 2e-05 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G167900 [exp] 212 / 1e-72 AT4G32090 117 / 7e-35 Beta-1,3-N-Acetylglucosaminyltransferase family protein (.1) Potri.006G257600 [exp] 81 / 7e-21 AT4G32105 77 / 4e-19 Beta-1,3-N-Acetylglucosaminyltransferase family protein (.1) Potri.008G105600 [exp] 41 / 4e-05 AT4G24972 106 / 2e-29 tapetum determinant 1 (.1) Potri.015G101000 [exp] 39 / 0.0002 AT1G32583 157 / 5e-49 unknown protein Potri.006G017600 [exp] 38 / 0.0006 AT1G32583 187 / 5e-61 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042384 [exp] 106 / 1e-30 AT4G32110 81 / 1e-20 Beta-1,3-N-Acetylglucosaminyltransferase family protein (.1) Lus10012177 [exp] 105 / 2e-30 AT4G32090 66 / 6e-15 Beta-1,3-N-Acetylglucosaminyltransferase family protein (.1) Lus10007569 [exp] 98 / 1e-27 AT4G32110 64 / 2e-14 Beta-1,3-N-Acetylglucosaminyltransferase family protein (.1) Lus10026289 [exp] 91 / 3e-24 AT4G32090 72 / 5e-17 Beta-1,3-N-Acetylglucosaminyltransferase family protein (.1) Lus10016744 [exp] 39 / 0.0002 AT4G24972 172 / 5e-55 tapetum determinant 1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.009G129400.2 pacid=42771165 polypeptide=Potri.009G129400.2.p locus=Potri.009G129400 ID=Potri.009G129400.2.v4.1 annot-version=v4.1 ATGGCAGGTCTCATCAAAGCTTTTGCTGCGACTCTTGTTTTATGCCTACTTACCAGAGGATCATGTGATTGCTCATTGAACAACATCACCATTGGGACAG TCCGAAGTGGGAGAGAAATAAGTGGTCAGGCAGATTGGAACGTGACAGTGGTAAACAACTGCCAATGTGCTCAAAGCCAAATACAGTTGTCTTGCATGGG GTTTCAAACAGTGGAAAATATTGACCCATCAATCCTTTCGAAGCAAGGTGATACCTGCCTGCTCATCAATGGCAGTTCCCTGGAGGCATCAGCTTCTGTC AACTTCTCCTATGCTTGGGATCCTCCTTTTCTGTTGTTGCCACTGGGCTCTGTTATCCATGGCTGTTAA
AA sequence Show only first row Show all	>Potri.009G129400.2 pacid=42771165 polypeptide=Potri.009G129400.2.p locus=Potri.009G129400 ID=Potri.009G129400.2.v4.1 annot-version=v4.1 MAGLIKAFAATLVLCLLTRGSCDCSLNNITIGTVRSGREISGQADWNVTVVNNCQCAQSQIQLSCMGFQTVENIDPSILSKQGDTCLLINGSSLEASASV NFSYAWDPPFLLLPLGSVIHGC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G32090			Beta-1,3-N-Acetylglucosaminylt...		Potri.009G129400 [exp]	0	1
AT2G30270			Protein of unknown function (D...		Potri.019G126300 [exp]	2.44	0.7687
AT5G23750			Remorin family protein (.1.2)		Potri.012G140800 [exp]	6.48	0.7588
AT4G32480			Protein of unknown function (D...		Potri.019G074400 [exp]	8.06	0.7516
AT1G05060			unknown protein		Potri.014G156700 [exp]	8.12	0.7543
AT5G24870			RING/U-box superfamily protein...		Potri.018G005600 [exp]	9.79	0.7437
AT2G42280	bHLH	bHLH130	basic helix-loop-helix (bHLH) ...		Potri.006G057600 [exp]	11.40	0.7280
AT1G54710		ATATG18H	homolog of yeast autophagy 18 ...		Potri.005G040300 [exp]	11.83	0.7421
AT1G17370		UBP1B	oligouridylate binding protein...		Potri.006G139300 [exp]	15.00	0.7196
AT3G56190		ASNAP, ALPHA-SN...	alpha-soluble NSF attachment p...		Potri.016G129900 [exp]	15.49	0.7379	ASNAP.2
AT1G14590			Nucleotide-diphospho-sugar tra...		Potri.015G029200 [exp]	16.61	0.7532

Compare expression of checked genes

Potri.009G129400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.