Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G21110 185 / 5e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT4G38700 181 / 3e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT2G21100 131 / 8e-39 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT1G65870 126 / 1e-36 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT1G22900 119 / 7e-34 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT5G42500 113 / 9e-32 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT5G42510 106 / 5e-29 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT3G13650 104 / 3e-28 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT1G58170 101 / 3e-27 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT5G49040 100 / 6e-27 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G061400 [exp] 187 / 6e-61 AT2G21110 223 / 7e-75 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.010G197000 [exp] 169 / 8e-54 AT2G21110 195 / 7e-64 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.009G131000 [exp] 145 / 2e-44 AT2G21100 236 / 4e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.016G061000 [exp] 139 / 7e-42 AT1G58170 214 / 2e-71 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.006G195300 [exp] 132 / 7e-39 AT5G49040 202 / 2e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.016G060700 [exp] 130 / 4e-38 AT1G65870 186 / 2e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.016G060900 [exp] 124 / 5e-36 AT1G58170 197 / 1e-64 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.001G023800 [exp] 120 / 1e-34 AT3G13650 171 / 2e-54 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.001G214600 [exp] 119 / 5e-34 AT2G21100 164 / 6e-52 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039561 [exp] 143 / 3e-43 AT3G13650 157 / 5e-49 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10029306 [exp] 135 / 3e-40 AT1G65870 208 / 5e-69 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10034476 [exp] 131 / 1e-38 AT2G21100 220 / 1e-73 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10025067 [exp] 125 / 3e-36 AT2G21100 214 / 3e-71 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10032939 [exp] 120 / 2e-34 AT5G42500 139 / 1e-41 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10017231 [exp] 120 / 2e-34 AT1G58170 191 / 2e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10042488 [exp] 119 / 7e-34 AT1G58170 202 / 1e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10025064 [exp] 116 / 4e-33 AT2G21100 197 / 9e-65 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10026176 [exp] 116 / 7e-33 AT1G58170 207 / 1e-68 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10030483 [exp] 115 / 4e-32 AT1G65870 164 / 1e-51 Disease resistance-responsive (dirigent-like protein) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0650 [poplar] [flax] AOC_barrel PF03018 [poplar] [flax] Dirigent Dirigent-like protein
Representative CDS sequence Show only first row Show all	>Potri.009G130900.1 pacid=42771118 polypeptide=Potri.009G130900.1.p locus=Potri.009G130900 ID=Potri.009G130900.1.v4.1 annot-version=v4.1 ATGGCAAGAATGGCAGCCTTTGTCTGTGCTTTGATCATCTGTATTGCTATTGTTCCAGCAGCATATGGTGAATATTACACAAAGAGTAGGCATGTCCCCA GGAAGGAGAAGGTGACCCGCCTTCACTTCTTCCTCCATGACATTCTTAGTGGAAAAAATCCTTCTGCTGTCAAGGTAGCCGGGTCTAATCGCACCGAAGG TGACAAATCACCAACACCATTTGGTAGCGTATACGCCATTGATGATCCTCTTAAAGTGGGACCTGAGCCAGACTCGAAGACTATAGGGAATGCACAAGGG CTCTATTTATCATCCAGCCAAGATTATAGTAAATTTACTATAGTGATGTGTGTTGATTTTGGATTTACAGAAGGTAAGTTCAAAGGAAGCTCATTTAGCG TGTTTTCGAGGAATCCAGTGACGGAGGCTGATCGCGAGGTTGCGGTGGTTGGAGGAAGAGGGAAGTTCAGGATGGCTAGAGGATTTGCCAAGGTCAAAAC TAGCCATTTCAATGCTACTAATGGTGATGCTGTTCTCGAGTATAAGGTCACTTTGATTCATTAG
AA sequence Show only first row Show all	>Potri.009G130900.1 pacid=42771118 polypeptide=Potri.009G130900.1.p locus=Potri.009G130900 ID=Potri.009G130900.1.v4.1 annot-version=v4.1 MARMAAFVCALIICIAIVPAAYGEYYTKSRHVPRKEKVTRLHFFLHDILSGKNPSAVKVAGSNRTEGDKSPTPFGSVYAIDDPLKVGPEPDSKTIGNAQG LYLSSSQDYSKFTIVMCVDFGFTEGKFKGSSFSVFSRNPVTEADREVAVVGGRGKFRMARGFAKVKTSHFNATNGDAVLEYKVTLIH

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G21110			Disease resistance-responsive ...		Potri.009G130900 [exp]	0	1
					Potri.012G066225 [exp]	16.24	0.7732
AT1G07410		ATRAB-A2B, AtRA...	ARABIDOPSIS RAB GTPASE HOMOLOG...		Potri.008G061300 [exp]	25.98	0.7349	RAB11.9
AT1G78580		ATTPS1	TREHALOSE-6-PHOSPHATE SYNTHASE...		Potri.004G064600 [exp]	27.54	0.6769
AT3G19550			unknown protein		Potri.001G296900 [exp]	56.83	0.7182
AT4G04980			unknown protein		Potri.011G047100 [exp]	78.65	0.7144
AT1G48380		HYP7, RHL1	HYPOCOTYL 7, root hair initiat...		Potri.004G069400 [exp]	147.66	0.6734
AT1G75550			glycine-rich protein (.1)		Potri.005G234601 [exp]	213.70	0.6411
AT1G06900			Insulinase (Peptidase family M...		Potri.013G154600 [exp]	250.20	0.6250

Compare expression of checked genes

Potri.009G130900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.