Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G34960 329 / 2e-115 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT2G29960 245 / 8e-83 CYP19-4, ATCYP5, CYP5 CYCLOPHILIN 19-4, ARABIDOPSIS THALIANA CYCLOPHILIN 5, cyclophilin 5 (.1.2) AT5G58710 241 / 4e-81 ROC7 rotamase CYP 7 (.1) AT3G55920 222 / 3e-73 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT4G38740 208 / 2e-68 ROC1 rotamase CYP 1 (.1) AT5G13120 207 / 3e-67 Pnsl5, ATCYP20-2 Photosynthetic NDH subcomplex L 5, ARABIDOPSIS THALIANA CYCLOPHILIN 20-2, cyclophilin 20-2 (.1.2) AT2G21130 202 / 2e-66 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT3G56070 202 / 3e-66 ROC2 rotamase cyclophilin 2 (.1.2) AT3G62030 201 / 9e-65 CYP20-3, ROC4 cyclophilin 20-3, rotamase CYP 4 (.1.2.3) AT2G16600 194 / 3e-63 ROC3 rotamase CYP 3 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G173500 [exp] 366 / 3e-130 AT4G34960 317 / 7e-111 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.009G046500 [exp] 245 / 1e-82 AT2G29960 323 / 4e-114 CYCLOPHILIN 19-4, ARABIDOPSIS THALIANA CYCLOPHILIN 5, cyclophilin 5 (.1.2) Potri.010G189000 [exp] 238 / 1e-79 AT3G55920 303 / 4e-105 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.001G251700 [exp] 237 / 1e-79 AT5G58710 313 / 6e-110 rotamase CYP 7 (.1) Potri.002G021500 [exp] 206 / 1e-67 AT2G16600 278 / 2e-97 rotamase CYP 3 (.1.2) Potri.009G130100 [exp] 204 / 3e-67 AT2G21130 279 / 1e-97 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.005G240200 [exp] 201 / 6e-66 AT2G16600 276 / 2e-96 rotamase CYP 3 (.1.2) Potri.009G106200 [exp] 207 / 1e-65 AT2G15790 561 / 0.0 SQUINT, CYCLOPHILIN 40, peptidyl-prolyl cis-trans isomerase / cyclophilin-40 (CYP40) / rotamase (.1) Potri.004G168800 [exp] 200 / 1e-65 AT2G16600 278 / 4e-97 rotamase CYP 3 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025052 [exp] 310 / 1e-106 AT4G34960 311 / 2e-107 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10040666 [exp] 244 / 3e-82 AT5G58710 347 / 2e-123 rotamase CYP 7 (.1) Lus10018238 [exp] 244 / 3e-82 AT2G29960 348 / 4e-124 CYCLOPHILIN 19-4, ARABIDOPSIS THALIANA CYCLOPHILIN 5, cyclophilin 5 (.1.2) Lus10014846 [exp] 241 / 3e-80 AT2G29960 310 / 6e-107 CYCLOPHILIN 19-4, ARABIDOPSIS THALIANA CYCLOPHILIN 5, cyclophilin 5 (.1.2) Lus10038315 [exp] 229 / 3e-76 AT2G29960 313 / 1e-109 CYCLOPHILIN 19-4, ARABIDOPSIS THALIANA CYCLOPHILIN 5, cyclophilin 5 (.1.2) Lus10030408 [exp] 231 / 7e-76 AT3G55920 333 / 5e-116 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10036180 [exp] 221 / 7e-73 AT2G29960 300 / 3e-104 CYCLOPHILIN 19-4, ARABIDOPSIS THALIANA CYCLOPHILIN 5, cyclophilin 5 (.1.2) Lus10012167 [exp] 204 / 7e-67 AT2G16600 313 / 4e-111 rotamase CYP 3 (.1.2) Lus10007579 [exp] 204 / 9e-67 AT2G16600 311 / 2e-110 rotamase CYP 3 (.1.2) Lus10023860 [exp] 203 / 3e-64 AT2G15790 599 / 0.0 SQUINT, CYCLOPHILIN 40, peptidyl-prolyl cis-trans isomerase / cyclophilin-40 (CYP40) / rotamase (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0475 [poplar] [flax] Cyclophil-like PF00160 [poplar] [flax] Pro_isomerase Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD
Representative CDS sequence Show only first row Show all	>Potri.009G132800.1 pacid=42771853 polypeptide=Potri.009G132800.1.p locus=Potri.009G132800 ID=Potri.009G132800.1.v4.1 annot-version=v4.1 ATGGTTAGAGTTTTTCCAGCGTGTGTGTTTCAACCTAAGTGCCTCCTTCTCTTCATTGTCCTGGTTATTTTTCTCATCTTTGCTTTTACCAATCCTAAGC AGGATGAAGTGAAGGAAGAAGAACAGGACTATGAGATAACACATAGAGTATACTTGGATATTGATATTGATGGGCAACGTCAGGGTAGAATTGTTATTGG ATTATATGGCGAGGTTGTACCAAAAACTGTAGAAAATTTCAGGGCTTTATGCACAGGGACAAAGCATAAGGGTGCAAGTGGGAAAGCCCTCCATTATAAG GGAATACCTTTTCACCGTATAATATCTGGCTTCATGATTCAAGGCGGTGACGTGGTTTACGGTGATGGGAGGGGAAGTGATTCTATATATGGCAGTGTTT TTCCTGATGAAAATTTTAAGATAAAACATTCACATGCAGGAGTTGTTTCCATGGTGAATTCAGGACCAAATTCCAATGGTTCTCAGTTTTTCATCACCAC CATCAAGGCTAGCTGGTTGGATGGAGAGCATGTTGTTTTTGGAAAGGTTATCCAAGGCATGGATATTGTTTATGCAATTGAAGGGGGAGCAGGAACGTAT AGTGGAAAACCCAGAAAGAAAGTAATTATTGCTGACTCGGGAGAGATACCCAAGGACAAGTGGGATGAGGAAAGATGA
AA sequence Show only first row Show all	>Potri.009G132800.1 pacid=42771853 polypeptide=Potri.009G132800.1.p locus=Potri.009G132800 ID=Potri.009G132800.1.v4.1 annot-version=v4.1 MVRVFPACVFQPKCLLLFIVLVIFLIFAFTNPKQDEVKEEEQDYEITHRVYLDIDIDGQRQGRIVIGLYGEVVPKTVENFRALCTGTKHKGASGKALHYK GIPFHRIISGFMIQGGDVVYGDGRGSDSIYGSVFPDENFKIKHSHAGVVSMVNSGPNSNGSQFFITTIKASWLDGEHVVFGKVIQGMDIVYAIEGGAGTY SGKPRKKVIIADSGEIPKDKWDEER

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G34960			Cyclophilin-like peptidyl-prol...		Potri.009G132800 [exp]	0	1
AT5G11870			Alkaline phytoceramidase (aPHC...		Potri.006G228700 [exp]	4.00	0.7123
AT4G33350		AtTic22-IV	translocon at the inner envelo...		Potri.014G030000 [exp]	4.58	0.8080
AT3G22680		RDM1	RNA-DIRECTED DNA METHYLATION 1...		Potri.008G155800 [exp]	5.83	0.6935
AT2G05630		ATG8D	Ubiquitin-like superfamily pro...		Potri.014G153800 [exp]	6.92	0.7402
AT5G58220		ALNS, TTL	allantoin synthase, transthyre...		Potri.002G238300 [exp]	8.83	0.7539
AT4G14145			unknown protein		Potri.010G223700 [exp]	10.95	0.7068
AT1G56423			unknown protein		Potri.013G008700 [exp]	12.72	0.7524
AT2G04340			unknown protein		Potri.014G169500 [exp]	14.07	0.7070
AT3G03330			NAD(P)-binding Rossmann-fold s...		Potri.013G084100 [exp]	16.61	0.6857
AT2G21170		PDTPI, TIM	PLASTID ISOFORM TRIOSE PHOSPHA...		Potri.009G129500 [exp]	17.49	0.7189	TIM.2

Compare expression of checked genes

Potri.009G132800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.