Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-ADF5.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G16700 257 / 6e-90 ADF5, ATADF5 actin depolymerizing factor 5 (.1.2) AT4G34970 246 / 3e-85 ADF9 actin depolymerizing factor 9 (.1) AT2G31200 191 / 1e-63 ADF6, ATADF6 actin depolymerizing factor 6 (.1) AT4G00680 189 / 7e-63 ADF8 actin depolymerizing factor 8 (.1) AT1G01750 181 / 6e-60 ADF11 actin depolymerizing factor 11 (.1) AT3G46010 179 / 7e-59 ATADF1, ADF1 actin depolymerizing factor 1 (.1.2) AT4G25590 178 / 1e-58 ADF7 actin depolymerizing factor 7 (.1) AT5G59890 178 / 2e-58 ADF4, ATADF4 actin depolymerizing factor 4 (.1.2) AT5G59880 172 / 5e-56 ADF3 actin depolymerizing factor 3 (.1.2) AT3G46000 171 / 1e-55 ADF2 actin depolymerizing factor 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G173800 [exp] 289 / 1e-102 AT2G16700 255 / 4e-89 actin depolymerizing factor 5 (.1.2) Potri.005G223800 [exp] 198 / 2e-66 AT2G31200 225 / 5e-77 actin depolymerizing factor 6 (.1) Potri.002G038800 [exp] 188 / 1e-62 AT2G31200 241 / 2e-83 actin depolymerizing factor 6 (.1) Potri.001G236700 [exp] 182 / 4e-60 AT5G59890 256 / 2e-89 actin depolymerizing factor 4 (.1.2) Potri.009G028200 [exp] 181 / 7e-60 AT5G59890 258 / 4e-90 actin depolymerizing factor 4 (.1.2) Potri.008G052100 [exp] 181 / 7e-60 AT5G59890 249 / 1e-86 actin depolymerizing factor 4 (.1.2) Potri.001G236400 [exp] 180 / 2e-59 AT5G59890 246 / 1e-85 actin depolymerizing factor 4 (.1.2) Potri.009G028100 [exp] 179 / 4e-59 AT5G59890 256 / 1e-89 actin depolymerizing factor 4 (.1.2) Potri.015G144500 [exp] 179 / 7e-59 AT4G25590 257 / 6e-90 actin depolymerizing factor 7 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025049 [exp] 256 / 2e-89 AT2G16700 232 / 9e-80 actin depolymerizing factor 5 (.1.2) Lus10034494 [exp] 218 / 2e-74 AT4G34970 202 / 2e-68 actin depolymerizing factor 9 (.1) Lus10022933 [exp] 196 / 2e-65 AT2G31200 254 / 9e-89 actin depolymerizing factor 6 (.1) Lus10024885 [exp] 190 / 3e-63 AT2G31200 230 / 3e-79 actin depolymerizing factor 6 (.1) Lus10024418 [exp] 190 / 4e-63 AT5G59890 249 / 6e-87 actin depolymerizing factor 4 (.1.2) Lus10024417 [exp] 186 / 2e-61 AT3G46010 250 / 3e-87 actin depolymerizing factor 1 (.1.2) Lus10025319 [exp] 186 / 2e-61 AT3G46010 250 / 3e-87 actin depolymerizing factor 1 (.1.2) Lus10008489 [exp] 180 / 2e-59 AT1G01750 192 / 2e-64 actin depolymerizing factor 11 (.1) Lus10023428 [exp] 172 / 2e-53 AT5G59890 244 / 4e-81 actin depolymerizing factor 4 (.1.2) Lus10027474 [exp] 165 / 2e-53 AT5G52360 244 / 6e-85 actin depolymerizing factor 10 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0092 [poplar] [flax] ADF PF00241 [poplar] [flax] Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein
Representative CDS sequence Show only first row Show all	>Potri.009G133100.1 pacid=42772767 polypeptide=Potri.009G133100.1.p locus=Potri.009G133100 ID=Potri.009G133100.1.v4.1 annot-version=v4.1 ATGGCGATGGCTTTCAAGATGGCAACAACTGGCATGTGGGTGACTGATGAGTGCAAGAATTCATTCCATCAAATGAAATGGAAGAGAGTTCATAGGTACA TAGTGTTCAAGATTGATGAGAAGTCAAGGTTGGTCACCGTGGACAAGGTTGGTGGCCCTGGTGAGAGCTATGATGATCTTGCTGCTTCATTACCGGATGA TGATTGCAGATATGCTGTGTTTGATTTCGATTTTGTCACTGTTGATAATTGCCGGAAGAGCAAGATCTTCTTCATTGCATGGGCTCCACCAGCATCAAGA ATCAGAGCAAAAATGCTTTATGCAACTTCCAAGGATGGATTAAGGAGAGTGCTTGAAGGCATCCACTATGAACTCCAAGCAACCGACCCAACTGAGATGG GGTTCGATTTGATTAGGGACCGAGCCAAATAA
AA sequence Show only first row Show all	>Potri.009G133100.1 pacid=42772767 polypeptide=Potri.009G133100.1.p locus=Potri.009G133100 ID=Potri.009G133100.1.v4.1 annot-version=v4.1 MAMAFKMATTGMWVTDECKNSFHQMKWKRVHRYIVFKIDEKSRLVTVDKVGGPGESYDDLAASLPDDDCRYAVFDFDFVTVDNCRKSKIFFIAWAPPASR IRAKMLYATSKDGLRRVLEGIHYELQATDPTEMGFDLIRDRAK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G16700		ADF5, ATADF5	actin depolymerizing factor 5 ...		Potri.009G133100 [exp]	0	1	Pt-ADF5.1
AT5G10150			Domain of unknown function (DU...		Potri.005G078300 [exp]	1.00	0.9193
AT2G40820			unknown protein		Potri.006G035300 [exp]	2.00	0.9115
AT5G22400			Rho GTPase activating protein ...		Potri.009G162900 [exp]	5.00	0.8723
AT2G21050		LAX2	like AUXIN RESISTANT 2 (.1)		Potri.009G132100 [exp]	5.19	0.8934	PtrAUX6,Pt-LAX5.1
AT4G38660			Pathogenesis-related thaumatin...		Potri.004G173200 [exp]	7.00	0.8689
AT3G53190			Pectin lyase-like superfamily ...		Potri.006G122000 [exp]	9.16	0.8807
AT2G19170		SLP3	subtilisin-like serine proteas...		Potri.006G076200 [exp]	10.39	0.8594	SLP3.1
AT2G35150		EXL7, EXL1	EXORDIUM LIKE 7, EXORDIUM like...		Potri.015G122100 [exp]	12.00	0.8602
AT3G08490			unknown protein		Potri.001G267200 [exp]	13.26	0.8436
AT3G54030			Protein kinase protein with te...		Potri.006G093900 [exp]	14.69	0.8714

Compare expression of checked genes

Potri.009G133100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.