Plant FIBer expression Database

Potri.009G133701 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
ATCG00170 102 / 4e-27 ATCG00170.1, RPOC2 DNA-directed RNA polymerase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G140260
[exp]
127 / 6e-36 ATCG00170 2104 / 0.0 DNA-directed RNA polymerase family protein (.1)
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.009G133701.1 pacid=42771937 polypeptide=Potri.009G133701.1.p locus=Potri.009G133701 ID=Potri.009G133701.1.v4.1 annot-version=v4.1
ATGGTTAGCTCATCACCAATCAAGAATCCCCAAGGAATTCTAACAATTCTTGTTATACACTCGTTCCAATTCTCCACTCTCTTTTCTAGGTTTATTGATA
TTGAATCAATTGAGCGCACTTCTAACACCTGTTCCACTTTTGAAAGACCCTGCGTTATATCACCAGATCTCGATTTTTCATATATAAATGTAACTAATGT
ATCTTTTTCATAA
AA sequence
>Potri.009G133701.1 pacid=42771937 polypeptide=Potri.009G133701.1.p locus=Potri.009G133701 ID=Potri.009G133701.1.v4.1 annot-version=v4.1
MVSSSPIKNPQGILTILVIHSFQFSTLFSRFIDIESIERTSNTCSTFERPCVISPDLDFSYINVTNVSFS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
ATCG00170 ATCG00170.1, RP... DNA-directed RNA polymerase fa... Potri.009G133701
[exp]
0 1
ATCG00500 ATCG00500.1, AC... acetyl-CoA carboxylase carboxy... Potri.013G162600
[exp]
9.59 0.8919
ATCG01280 ATCG01280.1, YC... Chloroplast Ycf2;ATPase, AAA t... Potri.013G143400
[exp]
18.16 0.8705
ATCG00170 ATCG00170.1, RP... DNA-directed RNA polymerase fa... Potri.019G028101
[exp]
23.23 0.8726
Potri.007G062061
[exp]
23.49 0.8686
ATCG01250 ATCG01250.1, ND... NADH-Ubiquinone/plastoquinone ... Potri.011G075051
[exp]
24.39 0.8688
ATCG00510 ATCG00510.1, PS... photsystem I subunit I (.1) Potri.016G094033
[exp]
25.90 0.8631
ATCG00500 ATCG00500.1, AC... acetyl-CoA carboxylase carboxy... Potri.005G150200
[exp]
26.49 0.8566
Potri.007G062081
[exp]
37.22 0.8537
ATCG00520 ATCG00520.1, YC... unfolded protein binding (.1) Potri.016G094067
[exp]
37.33 0.8611
ATCG00530 ATCG00530.1, YC... CemA-like proton extrusion pro... Potri.016G094100
[exp]
37.78 0.8545

Potri.009G133701 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.