Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G45740 206 / 2e-68 PEX11D peroxin 11D (.1.2.3) AT1G01820 202 / 8e-67 PEX11C peroxin 11c (.1) AT3G61070 201 / 3e-66 PEX11E peroxin 11E (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G076400 [exp] 222 / 2e-74 AT2G45740 392 / 4e-140 peroxin 11D (.1.2.3) Potri.002G153800 [exp] 219 / 2e-73 AT2G45740 400 / 1e-143 peroxin 11D (.1.2.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041368 [exp] 211 / 8e-70 AT1G01820 416 / 1e-149 peroxin 11c (.1) Lus10036560 [exp] 209 / 4e-69 AT1G01820 416 / 2e-149 peroxin 11c (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05648 [poplar] [flax] PEX11 Peroxisomal biogenesis factor 11 (PEX11)
Representative CDS sequence Show only first row Show all	>Potri.009G133900.1 pacid=42771358 polypeptide=Potri.009G133900.1.p locus=Potri.009G133900 ID=Potri.009G133900.1.v4.1 annot-version=v4.1 ATGAGTACACTCGATGCAACAAGAGCAGAACTCGCTCTTATAGTTCTGTATCTGAACAAGGCTGAAGCCAGGGACAAGATTTGTAGGGCAATTCAATATG GTTCAAAATTTTTGAGTGATGGACAAGCTGGTACTGCCCAAAATGTTGACAAATCAACCAGCTTAGCTCGGAAAGTTTTCCGTCTTTTTAAGTTTGTCAA CGATCTGCACGGTCTTATTAGTCCAGTTCAGTTCCTCAAGGGACCCCCTTGCCTCTTGTTTTACTGGGAAAGTCTAAAAATGCGTTGTTGTCAACTTTCT TGTTTCTTGATCAAAGGTAGAAGTGGGATTTACAAGAACAAAGAACGTGTTGAGCTAATTGGCCGGATTTCCCTTTTCTGTTGGATGGGATCCTCAATTT GTACTACTTTGGTTGAGGTTTGTAGCGTCTCCATTTTTTTTCTATTCTTTTCCTAG
AA sequence Show only first row Show all	>Potri.009G133900.1 pacid=42771358 polypeptide=Potri.009G133900.1.p locus=Potri.009G133900 ID=Potri.009G133900.1.v4.1 annot-version=v4.1 MSTLDATRAELALIVLYLNKAEARDKICRAIQYGSKFLSDGQAGTAQNVDKSTSLARKVFRLFKFVNDLHGLISPVQFLKGPPCLLFYWESLKMRCCQLS CFLIKGRSGIYKNKERVELIGRISLFCWMGSSICTTLVEVCSVSIFFLFFS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G45740		PEX11D	peroxin 11D (.1.2.3)		Potri.009G133900 [exp]	0	1
AT1G43850		SEU	SEUSS transcriptional co-regul...		Potri.010G052150 [exp]	2.44	0.8819
AT1G10417			unknown protein		Potri.008G190600 [exp]	3.31	0.8936
AT5G42480		ARC6	ACCUMULATION AND REPLICATION O...		Potri.002G027501 [exp]	3.74	0.8611
AT2G32540		ATCSLB4, ATCSLB...	CELLULOSE SYNTHASE LIKE B4, ce...		Potri.014G155401 [exp]	6.70	0.8794
AT1G73240			unknown protein		Potri.003G213050 [exp]	7.48	0.8782
AT1G06290		ATACX3, ACX3	acyl-CoA oxidase 3 (.1)		Potri.019G092600 [exp]	8.12	0.8228
AT4G39460		SAMC1, SAMT1	SAM TRANSPORTER1, S-adenosylme...		Potri.005G197200 [exp]	14.07	0.8688
AT5G06220			LETM1-like protein (.1.2)		Potri.001G187100 [exp]	18.02	0.8463
					Potri.004G111750 [exp]	18.33	0.8298
AT2G35160		SGD9, SUVH5	SET DOMAIN-CONTAINING PROTEIN ...		Potri.015G111884 [exp]	19.28	0.8242

Compare expression of checked genes

Potri.009G133900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.