Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G38580 167 / 6e-55 HIPP26, ATFP6 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) AT4G35060 151 / 2e-48 HIPP25 heavy metal associated isoprenylated plant protein 25, Heavy metal transport/detoxification superfamily protein (.1) AT5G66110 149 / 2e-47 HIPP27 heavy metal associated isoprenylated plant protein 27, Heavy metal transport/detoxification superfamily protein (.1) AT1G71050 126 / 1e-38 HIPP20 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) AT1G22990 109 / 8e-32 HIPP22 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) AT4G08570 99 / 1e-27 Heavy metal transport/detoxification superfamily protein (.1) AT5G17450 96 / 4e-27 HIPP21 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) AT4G39700 94 / 1e-25 Heavy metal transport/detoxification superfamily protein (.1) AT1G06330 57 / 4e-11 Heavy metal transport/detoxification superfamily protein (.1) AT2G18196 50 / 8e-09 Heavy metal transport/detoxification superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G135300 [exp] 187 / 1e-62 AT4G38580 234 / 3e-80 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Potri.004G175400 [exp] 183 / 5e-61 AT4G38580 254 / 2e-88 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Potri.005G110400 [exp] 139 / 1e-43 AT5G66110 189 / 2e-62 heavy metal associated isoprenylated plant protein 27, Heavy metal transport/detoxification superfamily protein (.1) Potri.010G114600 [exp] 112 / 6e-33 AT1G22990 194 / 9e-65 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) Potri.007G087300 [exp] 104 / 6e-30 AT4G39700 215 / 9e-73 Heavy metal transport/detoxification superfamily protein (.1) Potri.005G079800 [exp] 104 / 8e-30 AT4G39700 189 / 2e-62 Heavy metal transport/detoxification superfamily protein (.1) Potri.005G167000 [exp] 103 / 1e-29 AT4G08570 229 / 1e-78 Heavy metal transport/detoxification superfamily protein (.1) Potri.002G092200 [exp] 102 / 3e-29 AT4G08570 193 / 3e-64 Heavy metal transport/detoxification superfamily protein (.1) Potri.005G003700 [exp] 97 / 4e-27 AT4G08570 207 / 5e-70 Heavy metal transport/detoxification superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019789 [exp] 169 / 2e-55 AT4G38580 254 / 4e-88 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Lus10014120 [exp] 169 / 2e-55 AT4G38580 253 / 5e-88 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Lus10028426 [exp] 151 / 3e-48 AT4G38580 228 / 4e-78 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Lus10041879 [exp] 151 / 3e-48 AT4G38580 228 / 4e-78 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Lus10022508 [exp] 115 / 6e-34 AT4G39700 201 / 2e-67 Heavy metal transport/detoxification superfamily protein (.1) Lus10036004 [exp] 112 / 6e-33 AT1G22990 187 / 4e-62 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) Lus10016436 [exp] 110 / 2e-32 AT4G39700 209 / 1e-70 Heavy metal transport/detoxification superfamily protein (.1) Lus10019676 [exp] 110 / 2e-32 AT4G39700 211 / 3e-71 Heavy metal transport/detoxification superfamily protein (.1) Lus10016708 [exp] 110 / 2e-32 AT1G71050 192 / 1e-63 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) Lus10042946 [exp] 109 / 8e-32 AT1G71050 196 / 3e-65 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.009G135201.1 pacid=42771158 polypeptide=Potri.009G135201.1.p locus=Potri.009G135201 ID=Potri.009G135201.1.v4.1 annot-version=v4.1 ATGAAGGGTGTTAGTCAAGTGCTTGTGGATAGAAAGTCAAACAAGGTGACAGTCGTTGGATATGTGGAGCCAGCAAGGGTGCTCGCTCGCATTGCACATC GCACGGGTAAGAAGGCAGAGCTGTGGCCATACGTGCCATATGACACGGTGGCCCACCCTTATACAGCTGGGGTTTACGACAAAAAGGCCCCTGCTGGGTA CGTGAGAAGTAATCAGGACCCACAAGTGTCCCAATTCGCACGTGCGAGCTCCTTCGAGGTTCGATACACTACTGCTTTCAGTGATGAGAACCCTACAGCT TGTGCTGTTATGTGA
AA sequence Show only first row Show all	>Potri.009G135201.1 pacid=42771158 polypeptide=Potri.009G135201.1.p locus=Potri.009G135201 ID=Potri.009G135201.1.v4.1 annot-version=v4.1 MKGVSQVLVDRKSNKVTVVGYVEPARVLARIAHRTGKKAELWPYVPYDTVAHPYTAGVYDKKAPAGYVRSNQDPQVSQFARASSFEVRYTTAFSDENPTA CAVM

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G38580		HIPP26, ATFP6	HEAVY METAL ASSOCIATED ISOPREN...		Potri.009G135201 [exp]	0	1
AT2G21180			unknown protein		Potri.009G129200 [exp]	1.41	0.7213
AT5G22000		RHF2A, CIC7E11	RING-H2 group F2A (.1.2.3)		Potri.006G200200 [exp]	10.72	0.6732
AT4G34610	HD	BLH6	BEL1-like homeodomain 6 (.1.2)		Potri.009G120800 [exp]	11.09	0.6888
AT2G11890			adenylate cyclases (.1.2)		Potri.006G062000 [exp]	11.31	0.6520
AT1G12760			Zinc finger, C3HC4 type (RING ...		Potri.003G123300 [exp]	13.11	0.6870
AT4G39140			RING/U-box superfamily protein...		Potri.009G120000 [exp]	16.61	0.6687
AT3G47550			RING/FYVE/PHD zinc finger supe...		Potri.010G169200 [exp]	17.88	0.6191
AT3G23280		XBAT35	XB3 ortholog 5 in Arabidopsis ...		Potri.010G070750 [exp]	23.55	0.6219
AT5G62000	ARF	ORE14, HSS, ARF...	ORESARA 14, HLS1 SUPPRESSOR, A...		Potri.015G105300 [exp]	23.62	0.6494	Pt-ARF2.1
AT4G27310	CO		B-box type zinc finger family ...		Potri.013G150500 [exp]	29.10	0.6600

Compare expression of checked genes

Potri.009G135201 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.