Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G35070 135 / 7e-39 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) AT1G45976 90 / 1e-20 SBP1 S-ribonuclease binding protein 1 (.1) AT3G12920 82 / 6e-18 BRG3 BOI-related gene 3, SBP (S-ribonuclease binding protein) family protein (.1) AT5G45100 80 / 2e-17 BRG1 BOI-related gene 1, SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) AT1G32740 78 / 2e-16 SBP (S-ribonuclease binding protein) family protein (.1) AT1G79110 77 / 6e-16 BRG2 BOI-related gene 2, zinc ion binding (.1.2) AT1G60610 70 / 1e-13 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2), SBP (S-ribonuclease binding protein) family protein (.3) AT4G19700 69 / 3e-13 BOI, RING Botrytis Susceptible1 Interactor, SBP (S-ribonuclease binding protein) family protein (.1) AT1G10650 64 / 1e-11 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) AT5G47050 62 / 4e-11 SBP (S-ribonuclease binding protein) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G175500 [exp] 355 / 2e-124 AT4G35070 142 / 1e-41 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Potri.005G242600 [exp] 138 / 2e-39 AT4G35070 135 / 3e-38 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Potri.002G019000 [exp] 137 / 7e-39 AT4G35070 148 / 6e-43 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Potri.014G027000 [exp] 97 / 3e-23 AT1G45976 380 / 2e-132 S-ribonuclease binding protein 1 (.1) Potri.015G118000 [exp] 92 / 1e-21 AT5G45100 259 / 2e-85 BOI-related gene 1, SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Potri.002G124700 [exp] 90 / 9e-21 AT1G45976 378 / 2e-131 S-ribonuclease binding protein 1 (.1) Potri.012G119200 [exp] 81 / 2e-17 AT5G45100 244 / 1e-79 BOI-related gene 1, SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Potri.001G439600 [exp] 76 / 1e-15 AT3G12920 256 / 1e-83 BOI-related gene 3, SBP (S-ribonuclease binding protein) family protein (.1) Potri.010G042200 [exp] 76 / 1e-15 AT1G10650 393 / 2e-137 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019790 [exp] 197 / 3e-63 AT4G35070 170 / 1e-53 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Lus10014118 [exp] 196 / 1e-62 AT4G35070 171 / 7e-54 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Lus10013569 [exp] 97 / 2e-23 AT4G35070 125 / 1e-34 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Lus10017276 [exp] 92 / 3e-22 AT4G35070 122 / 2e-34 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Lus10001131 [exp] 89 / 4e-20 AT1G45976 407 / 7e-143 S-ribonuclease binding protein 1 (.1) Lus10031202 [exp] 87 / 1e-19 AT3G12920 255 / 3e-83 BOI-related gene 3, SBP (S-ribonuclease binding protein) family protein (.1) Lus10031780 [exp] 86 / 3e-19 AT3G12920 260 / 3e-85 BOI-related gene 3, SBP (S-ribonuclease binding protein) family protein (.1) Lus10030891 [exp] 81 / 1e-17 AT1G10650 275 / 1e-92 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Lus10030597 [exp] 79 / 2e-16 AT1G10650 380 / 3e-132 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Lus10030599 [exp] 78 / 2e-16 AT1G10650 380 / 4e-132 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0229 [poplar] [flax] RING PF13920 [poplar] [flax] zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Representative CDS sequence Show only first row Show all	>Potri.009G135400.2 pacid=42771767 polypeptide=Potri.009G135400.2.p locus=Potri.009G135400 ID=Potri.009G135400.2.v4.1 annot-version=v4.1 ATGGCAATAGAAGCACAGTTTCCATTTTGTGGAGGGTCACAACAGGATTGGATGGATTATGGCTGTGGAGGTTTAAATCAGCACTTCAATGTTCAGCAAC AAAAACAGCAGCAGCTGCAGCAATGTAACATGCATCAGCTACAGAGTTACCAGCTTCAAAGGAATCAAGATCTTTTCTCTGATAACACTCTTGTTTCTGC TTCGAAAAATAACTGCAACACCAGTAATCTTTCAATGGGTACCTTGGCCTCCTACGATGAGAAGCAAAGACAAGAGATTGATCACTATATCAGACTGCAG AATGAGAGATTGAGATTGGTGTTACAAGAGCAAAAAAGGCAGCAGCTTGGATTGTTGTTAAAGAAACTAGAATCAAAGGCCCTGCCTATATTGAAACAGA AGGATGAAGAAATAGCACAGGCAGCTAAAAGAACAGTGGAGCTTGGAGAGTTCTTGAAGAAACTAGAGTTTGAGAATCAAACATGGCAAAGAATGGCTCA AGAAAACGAAGCCATGGTTGTTTCTCTCAACAACACAATTGAACAGCTAAGAGAAAATTCATCTGGTTGCTTTAACAATGGTGCAGAGGATTCAGAGTCC TGCTGCGATGTTAGTAGCGGAGCAGAGGAGGGGTTGCTTGATGCCGCTGATGACACAGCGAGAAAGATGGTGATGGTATGCAAGGGATGTAATTCTAGGA ATTCGTGCATTTTGTTCCTTCCTTGCAGGCACCTTTGCTCATGTAAAGCTTGTGAGGCTTTTCTTGATTCTTGTCCGGTGTGTCAAACACCAAAGAAGGC CAGTATCGAGGCTTTAATGGTTTAG
AA sequence Show only first row Show all	>Potri.009G135400.2 pacid=42771767 polypeptide=Potri.009G135400.2.p locus=Potri.009G135400 ID=Potri.009G135400.2.v4.1 annot-version=v4.1 MAIEAQFPFCGGSQQDWMDYGCGGLNQHFNVQQQKQQQLQQCNMHQLQSYQLQRNQDLFSDNTLVSASKNNCNTSNLSMGTLASYDEKQRQEIDHYIRLQ NERLRLVLQEQKRQQLGLLLKKLESKALPILKQKDEEIAQAAKRTVELGEFLKKLEFENQTWQRMAQENEAMVVSLNNTIEQLRENSSGCFNNGAEDSES CCDVSSGAEEGLLDAADDTARKMVMVCKGCNSRNSCILFLPCRHLCSCKACEAFLDSCPVCQTPKKASIEALMV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G35070			SBP (S-ribonuclease binding pr...		Potri.009G135400 [exp]	0	1
AT3G60260			ELMO/CED-12 family protein (.1...		Potri.014G049800 [exp]	10.67	0.7242
AT1G71340		AtGDPD4	glycerophosphodiester phosphod...		Potri.013G095300 [exp]	31.24	0.7129
AT5G22920			CHY-type/CTCHY-type/RING-type ...		Potri.006G121801 [exp]	35.94	0.6884
AT5G02410		ALG10	homolog of yeast ALG10, DIE2/A...		Potri.006G084800 [exp]	51.94	0.6487
AT1G18680			HNH endonuclease domain-contai...		Potri.012G067700 [exp]	58.27	0.7014
AT3G01850			Aldolase-type TIM barrel famil...		Potri.001G332700 [exp]	68.27	0.6906
AT1G68000		ATPIS1	phosphatidylinositol synthase ...		Potri.009G135500 [exp]	79.09	0.6791
AT3G26935			DHHC-type zinc finger family p...		Potri.001G325400 [exp]	100.21	0.6705
AT5G63260	C3HZnF		Zinc finger C-x8-C-x5-C-x3-H t...		Potri.018G108850 [exp]	119.90	0.6250
AT2G35760			Uncharacterised protein family...		Potri.006G016900 [exp]	121.79	0.6442

Compare expression of checked genes

Potri.009G135400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.