Plant FIBer expression Database

Potri.009G140200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G16210 229 / 5e-76 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012520
[exp]
217 / 3e-71 AT1G16210 307 / 1e-106 unknown protein
Lus10022649
[exp]
214 / 8e-70 AT1G16210 302 / 1e-104 unknown protein
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0114 HMG-box PF06244 Ccdc124 Coiled-coil domain-containing protein 124 /Oxs1
Representative CDS sequence
>Potri.009G140200.1 pacid=42772592 polypeptide=Potri.009G140200.1.p locus=Potri.009G140200 ID=Potri.009G140200.1.v4.1 annot-version=v4.1
ATGCCGAAGAAGATGGGAGTGAACAGCAAAGCCGAAGAGGCTCGAGCTCGTAAGAACGCAACAGAAGCCGATAAAAAGTCTCGCGAGGCTCGCGAGAAAG
AGGAACAGTACTGGCGCGAAGCCGAGGGGTCGAAATCACGCGCTGCGAAGAAACGTGAGGAAGAATCGGAGAAAAGAGCTGAAGCCGCCGCGCGTAAAGC
CGAGGCGCGCAGATTAGCGGAGCAGGAAGAGAAGGAGCTGGAGAAGGCTATGAAGAAGCCGGATAAGAAGGCGAATAGGGTTTCGATTCCGGTGAAGGTG
ACGGAAGCGGAGTTGATGAAGAGGAGGGAGGAGGAACAAGCGGAGATGGCGAGGAAAGCGGATGAGGCGAAGAAGAGAAAGGATAGGACCGCGGAGGAAG
AGGAGTATGAGAGGATGGTGCTGGTTTCGAATACGAATAGGGATGACTCGATTATTGAAGCGAGTAGTGTTGAGGAAGCGATTGCGCGGATCAGTGTTGC
TGATAACTTGCCTGCTGATCGGCATCCTGAGAGGAGGCTTAAGGCCTCGTTTAAGGCTTTTGAAGAAGCTGAGCTCCCCAAGCTCAAGGAAGAGAAGCCA
GGCCTTACACATACACAATACAAGGACATGATATGGAAGCTATGGAAGAAATCTCCTGACAATCCTCTTAACCAGGCTAGTGAGTGA
AA sequence
>Potri.009G140200.1 pacid=42772592 polypeptide=Potri.009G140200.1.p locus=Potri.009G140200 ID=Potri.009G140200.1.v4.1 annot-version=v4.1
MPKKMGVNSKAEEARARKNATEADKKSREAREKEEQYWREAEGSKSRAAKKREEESEKRAEAAARKAEARRLAEQEEKELEKAMKKPDKKANRVSIPVKV
TEAELMKRREEEQAEMARKADEAKKRKDRTAEEEEYERMVLVSNTNRDDSIIEASSVEEAIARISVADNLPADRHPERRLKASFKAFEEAELPKLKEEKP
GLTHTQYKDMIWKLWKKSPDNPLNQASE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G16210 unknown protein Potri.009G140200
[exp]
0 1
AT3G12160 AtRABA4d ARABIDOPSIS THALIANA RAB GTPAS... Potri.001G270100
[exp]
1.00 0.8037 RAB11.15
AT2G06530 VPS2.1 SNF7 family protein (.1) Potri.001G170400
[exp]
2.82 0.7707
AT1G17530 ATTIM23-1 translocase of inner mitochond... Potri.001G198100
[exp]
3.00 0.7573 ATTIM23.2
AT2G21600 ATRER1B endoplasmatic reticulum retrie... Potri.005G228900
[exp]
5.29 0.7523 RER1.4
AT3G51100 unknown protein Potri.005G117400
[exp]
5.38 0.6594
AT1G68140 Protein of unknown function (D... Potri.003G021800
[exp]
6.00 0.6995
AT1G12110 CHL1-1, CHL1, B... CHLORINA 1, ARABIDOPSIS THALIA... Potri.003G111500
[exp]
6.48 0.6828 Pt-PPNRT1.2
AT4G13110 BSD domain-containing protein ... Potri.008G199000
[exp]
6.92 0.7114
AT4G01840 KCO5, ATTPK5, A... Ca2+ activated outward rectify... Potri.014G113700
[exp]
7.00 0.7287
AT2G28200 C2H2ZnF C2H2-type zinc finger family p... Potri.004G216900
[exp]
8.48 0.6668

Potri.009G140200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.