Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G29510 139 / 4e-43 SAUR68 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1) AT1G29500 139 / 6e-43 SAUR-like auxin-responsive protein family (.1) AT1G29450 135 / 1e-41 SAUR-like auxin-responsive protein family (.1) AT5G27780 135 / 2e-41 SAUR-like auxin-responsive protein family (.1) AT1G29420 134 / 7e-41 SAUR-like auxin-responsive protein family (.1) AT1G29430 133 / 1e-40 SAUR-like auxin-responsive protein family (.1) AT1G29460 133 / 1e-40 SAUR-like auxin-responsive protein family (.1) AT1G29440 122 / 3e-36 SAUR-like auxin-responsive protein family (.1) AT1G29490 113 / 3e-33 SAUR-like auxin-responsive protein family (.1) AT1G76190 76 / 3e-18 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G141000 [exp] 154 / 5e-49 AT1G29500 122 / 2e-36 SAUR-like auxin-responsive protein family (.1) Potri.017G043400 [exp] 154 / 9e-49 AT5G27780 141 / 8e-44 SAUR-like auxin-responsive protein family (.1) Potri.004G181400 [exp] 152 / 3e-48 AT1G29450 132 / 4e-40 SAUR-like auxin-responsive protein family (.1) Potri.009G141201 [exp] 145 / 3e-45 AT5G27780 132 / 3e-40 SAUR-like auxin-responsive protein family (.1) Potri.017G043500 [exp] 142 / 2e-44 AT5G27780 120 / 1e-35 SAUR-like auxin-responsive protein family (.1) Potri.009G141150 [exp] 140 / 3e-43 AT1G29450 131 / 5e-40 SAUR-like auxin-responsive protein family (.1) Potri.009G141100 [exp] 126 / 6e-38 AT1G29510 117 / 8e-35 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1) Potri.002G064300 [exp] 126 / 8e-38 AT1G29510 109 / 2e-31 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1) Potri.017G043600 [exp] 125 / 1e-37 AT1G29500 131 / 4e-40 SAUR-like auxin-responsive protein family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025114 [exp] 115 / 3e-33 AT1G29450 99 / 4e-27 SAUR-like auxin-responsive protein family (.1) Lus10023970 [exp] 111 / 8e-32 AT1G29450 97 / 2e-26 SAUR-like auxin-responsive protein family (.1) Lus10023969 [exp] 104 / 6e-29 AT5G27780 96 / 1e-25 SAUR-like auxin-responsive protein family (.1) Lus10025115 [exp] 99 / 4e-27 AT1G29430 88 / 6e-23 SAUR-like auxin-responsive protein family (.1) Lus10003337 [exp] 86 / 5e-20 AT5G22800 855 / 0.0 EMBRYO DEFECTIVE 86, EMBRYO DEFECTIVE 263, EMBRYO DEFECTIVE 1030, Alanyl-tRNA synthetase, class IIc (.1) Lus10007060 [exp] 72 / 8e-17 AT1G29430 71 / 2e-16 SAUR-like auxin-responsive protein family (.1) Lus10020432 [exp] 69 / 9e-16 AT1G20470 69 / 3e-16 SAUR-like auxin-responsive protein family (.1) Lus10034570 [exp] 69 / 9e-16 AT1G76190 122 / 2e-37 SAUR-like auxin-responsive protein family (.1) Lus10034507 [exp] 69 / 3e-15 AT1G75590 189 / 1e-62 SAUR-like auxin-responsive protein family (.1) Lus10033161 [exp] 68 / 7e-15 AT1G75590 187 / 4e-62 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [poplar] [flax] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Potri.009G140900.1 pacid=42772695 polypeptide=Potri.009G140900.1.p locus=Potri.009G140900 ID=Potri.009G140900.1.v4.1 annot-version=v4.1 ATGATCACCCCCGTGAAACTTATCAAGATGGCAAGGAAGTGGCAAAGTCTAGCTGCCCTAAAGAGGAAAAGAATTTCATTACAAAGAAACCATAGTAATG CAAGTACTAGCAGTAGCAACATGCCAACAGTGGCGGATAAGGGCCATTTTGTTGTCTACACAGCTGATCAAAGACGTTTCATGTTTCCTATTTCATACCT TAACAACAACATTGTTAGAAAACTCTTGGTAATGTCTGAGGAAGAATTTGGCCTGCCAGGCGACGGACCGATCACATTACCGTGTGATGCAGTCTTCATG GAATATGTATGTTCTTTGATCCAAGGGAGAGTCGACAAAGAAATCGAAAAGGCTATGCTTATGTCAGTAATTAGTAGCAGATCATGTTCATTATCTTCTT GTCCCAGTCAAGGGCAAACTCGCCAGCAGTCTTTAGTATATAGTTTCTGA
AA sequence Show only first row Show all	>Potri.009G140900.1 pacid=42772695 polypeptide=Potri.009G140900.1.p locus=Potri.009G140900 ID=Potri.009G140900.1.v4.1 annot-version=v4.1 MITPVKLIKMARKWQSLAALKRKRISLQRNHSNASTSSSNMPTVADKGHFVVYTADQRRFMFPISYLNNNIVRKLLVMSEEEFGLPGDGPITLPCDAVFM EYVCSLIQGRVDKEIEKAMLMSVISSRSCSLSSCPSQGQTRQQSLVYSF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G29510		SAUR68	SMALL AUXIN UPREGULATED 68, SA...		Potri.009G140900 [exp]	0	1
AT1G29670			GDSL-like Lipase/Acylhydrolase...		Potri.004G064500 [exp]	5.29	0.9961
AT2G20870			cell wall protein precursor, p...		Potri.013G144200 [exp]	8.48	0.9958
AT5G20630		ATGER3, GLP3A, ...	GERMIN-LIKE PROTEIN 3, ARABIDO...		Potri.006G142600 [exp]	10.95	0.9956
AT4G03270		CYCD6;1	Cyclin D6;1 (.1)		Potri.004G032100 [exp]	12.24	0.9838
AT1G33811			GDSL-like Lipase/Acylhydrolase...		Potri.013G102400 [exp]	12.32	0.9955
AT1G54820			Protein kinase superfamily pro...		Potri.005G036600 [exp]	14.49	0.9954
AT5G62360			Plant invertase/pectin methyle...		Potri.015G128400 [exp]	15.29	0.9954
AT2G42990			GDSL-like Lipase/Acylhydrolase...		Potri.002G219700 [exp]	16.09	0.9953
					Potri.002G252200 [exp]	16.91	0.9944
AT4G00165			Bifunctional inhibitor/lipid-t...		Potri.014G059800 [exp]	17.88	0.9952

Compare expression of checked genes

Potri.009G140900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.