Potri.009G144100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G27580 166 / 4e-53 A20/AN1-like zinc finger family protein (.1.2)
AT2G36320 158 / 5e-50 A20/AN1-like zinc finger family protein (.1)
AT3G52800 150 / 4e-47 A20/AN1-like zinc finger family protein (.1)
AT1G12440 134 / 8e-41 A20/AN1-like zinc finger family protein (.1.2)
AT4G12040 133 / 5e-40 AtSAP7 stress-associated protein 7, A20/AN1-like zinc finger family protein (.1.2)
AT4G22820 132 / 9e-40 A20/AN1-like zinc finger family protein (.1.2)
AT1G51200 122 / 1e-35 A20/AN1-like zinc finger family protein (.1.2.3.4)
AT4G14225 102 / 2e-28 A20/AN1-like zinc finger family protein (.1)
AT3G12630 95 / 2e-25 SAP5 stress associated protein 5, A20/AN1-like zinc finger family protein (.1)
AT4G25380 86 / 5e-22 AtSAP10, SAP10 Arabidopsis thaliana stress-associated protein 10, stress-associated protein 10 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G184300 226 / 4e-77 AT2G27580 156 / 4e-49 A20/AN1-like zinc finger family protein (.1.2)
Potri.003G205500 141 / 4e-43 AT1G51200 202 / 4e-67 A20/AN1-like zinc finger family protein (.1.2.3.4)
Potri.016G051700 140 / 6e-43 AT1G51200 164 / 3e-52 A20/AN1-like zinc finger family protein (.1.2.3.4)
Potri.006G056500 140 / 7e-43 AT1G51200 167 / 2e-53 A20/AN1-like zinc finger family protein (.1.2.3.4)
Potri.001G018600 139 / 1e-42 AT1G51200 203 / 2e-67 A20/AN1-like zinc finger family protein (.1.2.3.4)
Potri.001G115000 133 / 4e-40 AT4G12040 169 / 4e-54 stress-associated protein 7, A20/AN1-like zinc finger family protein (.1.2)
Potri.003G117100 127 / 1e-37 AT1G12440 170 / 2e-54 A20/AN1-like zinc finger family protein (.1.2)
Potri.007G078500 121 / 1e-35 AT4G12040 120 / 6e-35 stress-associated protein 7, A20/AN1-like zinc finger family protein (.1.2)
Potri.009G063900 111 / 2e-31 AT3G12630 166 / 5e-53 stress associated protein 5, A20/AN1-like zinc finger family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003246 150 / 8e-47 AT2G36320 201 / 3e-67 A20/AN1-like zinc finger family protein (.1)
Lus10006671 143 / 3e-44 AT1G12440 204 / 3e-68 A20/AN1-like zinc finger family protein (.1.2)
Lus10007015 143 / 6e-44 AT1G12440 207 / 3e-69 A20/AN1-like zinc finger family protein (.1.2)
Lus10020594 139 / 1e-42 AT2G36320 149 / 2e-46 A20/AN1-like zinc finger family protein (.1)
Lus10031833 132 / 8e-40 AT1G51200 186 / 5e-61 A20/AN1-like zinc finger family protein (.1.2.3.4)
Lus10028903 130 / 4e-39 AT1G12440 205 / 3e-68 A20/AN1-like zinc finger family protein (.1.2)
Lus10008912 128 / 3e-38 AT1G12440 202 / 4e-67 A20/AN1-like zinc finger family protein (.1.2)
Lus10031262 127 / 8e-38 AT1G51200 187 / 2e-61 A20/AN1-like zinc finger family protein (.1.2.3.4)
Lus10035603 111 / 5e-32 AT2G36320 152 / 3e-48 A20/AN1-like zinc finger family protein (.1)
Lus10030150 108 / 1e-30 AT4G12040 119 / 8e-35 stress-associated protein 7, A20/AN1-like zinc finger family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01428 zf-AN1 AN1-like Zinc finger
PF01754 zf-A20 A20-like zinc finger
Representative CDS sequence
>Potri.009G144100.3 pacid=42771020 polypeptide=Potri.009G144100.3.p locus=Potri.009G144100 ID=Potri.009G144100.3.v4.1 annot-version=v4.1
ATGGCAGAAGAACAACACCGATGCCAAGAACCACGTCTCTGCGTAAACAACTGCGGTTTTTTTGGAAGCCCAGCAACTCAAAATCTGTGTTCTAAATGTT
ATGGTGATCTTCGTCAATCACAGCCCCTGAATCAGCTCCTAGCCCCATCATCATCTGCTTCTGTTTCTTCCTTTTCATCCCCAACCGTCGATGTTATAAA
GAACCAGATAGCTCCCGTGTTGGTGGTGGAAGGTGATGAAAAAGGGGAGTTTAAGGCTGAACCTACGGTTGTGGTTCCACAGCAGAAGCCAAATAGGTGC
TTGACGTGTAGGAGGCGCGTAGGGTTGACGGGATTTAATTGCAGGTGTGGTATGGTGTTTTGTGGAACGCATAGGTACCCAGAACAACATGATTGTGAGT
TTGATTTTAAGAGCTTAGGTAAAGAACAGATCGCTAAGGCTAATCCTGTTGTTAAGGGTGAGAAGCTTCAAAGGATTTAA
AA sequence
>Potri.009G144100.3 pacid=42771020 polypeptide=Potri.009G144100.3.p locus=Potri.009G144100 ID=Potri.009G144100.3.v4.1 annot-version=v4.1
MAEEQHRCQEPRLCVNNCGFFGSPATQNLCSKCYGDLRQSQPLNQLLAPSSSASVSSFSSPTVDVIKNQIAPVLVVEGDEKGEFKAEPTVVVPQQKPNRC
LTCRRRVGLTGFNCRCGMVFCGTHRYPEQHDCEFDFKSLGKEQIAKANPVVKGEKLQRI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G27580 A20/AN1-like zinc finger famil... Potri.009G144100 0 1
AT5G42050 DCD (Development and Cell Deat... Potri.001G088800 3.87 0.7812
AT3G16640 TCTP translationally controlled tum... Potri.005G024800 6.48 0.7575 Pt-TCTP.1
AT1G01720 NAC ATAF1, ANAC002 Arabidopsis NAC domain contain... Potri.007G099400 7.68 0.8349
AT1G65770 AMR1 ascorbic acid mannose pathway ... Potri.005G105000 9.48 0.7566
AT4G24290 MAC/Perforin domain-containing... Potri.019G001000 11.40 0.7637
AT5G47220 AP2_ERF ATERF-2, ERF2, ... ETHYLENE RESPONSE FACTOR- 2, e... Potri.004G051700 13.03 0.7991
AT2G27580 A20/AN1-like zinc finger famil... Potri.004G184300 13.85 0.7064
AT5G14420 RGLG2 RING domain ligase2 (.1.2.3.4) Potri.010G049600 16.15 0.7825
AT4G33430 SERK3, RKS10, E... RECEPTOR KINASES LIKE SERK 10,... Potri.001G206700 18.84 0.7042
AT1G29340 ATPUB17, PUB17 ARABIDOPSIS THALIANA PLANT U-B... Potri.011G071400 22.71 0.7667

Potri.009G144100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.