Potri.009G146200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G27710 89 / 2e-24 60S acidic ribosomal protein family (.1.2.3.4)
AT3G44590 87 / 3e-23 60S acidic ribosomal protein family (.1.2)
AT2G27720 87 / 3e-23 60S acidic ribosomal protein family (.1.2.3)
AT3G28500 79 / 3e-20 60S acidic ribosomal protein family (.1)
AT5G40040 76 / 7e-19 60S acidic ribosomal protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G185800 125 / 2e-38 AT2G27710 89 / 4e-24 60S acidic ribosomal protein family (.1.2.3.4)
Potri.010G236400 91 / 5e-25 AT2G27710 90 / 1e-24 60S acidic ribosomal protein family (.1.2.3.4)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10043377 102 / 1e-28 AT2G27710 102 / 8e-29 60S acidic ribosomal protein family (.1.2.3.4)
Lus10020575 100 / 1e-28 AT3G44590 100 / 9e-29 60S acidic ribosomal protein family (.1.2)
Lus10006270 103 / 2e-28 AT2G27710 100 / 9e-27 60S acidic ribosomal protein family (.1.2.3.4)
Lus10019533 103 / 2e-27 AT3G44620 262 / 6e-87 protein tyrosine phosphatases;protein tyrosine phosphatases (.1.2)
Lus10014070 96 / 7e-27 AT2G27710 92 / 1e-25 60S acidic ribosomal protein family (.1.2.3.4)
Lus10019846 96 / 1e-26 AT2G27710 92 / 2e-25 60S acidic ribosomal protein family (.1.2.3.4)
Lus10026714 94 / 6e-26 AT3G44590 96 / 6e-27 60S acidic ribosomal protein family (.1.2)
Lus10026712 95 / 7e-25 AT3G44590 97 / 2e-25 60S acidic ribosomal protein family (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00428 Ribosomal_60s 60s Acidic ribosomal protein
Representative CDS sequence
>Potri.009G146200.1 pacid=42772890 polypeptide=Potri.009G146200.1.p locus=Potri.009G146200 ID=Potri.009G146200.1.v4.1 annot-version=v4.1
ATGAAGGTTGTCGCCGCTTACTTGCTCGCCGTTCTCGGTGGCAACACCTGCCCTACCGCCGAGGATTTGAAAAACATCCTTGGATCTGTTGGCGCTGATG
CTGACGATGACAGGATCGAGTTGCTGTTGTCCAGTGTGAAAGGAAAGGACATCACTGAGCTGATTGCTTCCGGCAGGGAAAAGTTGGCTTCCGTTCCATC
CGGTGGTGGTGTTGCTGTTTCTGCCGGTGCTGCTCCTGCTGCTGCTGGTGGTGCTGCTCCTGCTGCTGAGGCTAAGAAAGAGGAGAAGGTTGAAGAGAAA
GAGGAGTCTGATGATGATATGGGCTTCAGCCTGTTCGATTAA
AA sequence
>Potri.009G146200.1 pacid=42772890 polypeptide=Potri.009G146200.1.p locus=Potri.009G146200 ID=Potri.009G146200.1.v4.1 annot-version=v4.1
MKVVAAYLLAVLGGNTCPTAEDLKNILGSVGADADDDRIELLLSSVKGKDITELIASGREKLASVPSGGGVAVSAGAAPAAAGGAAPAAEAKKEEKVEEK
EESDDDMGFSLFD

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G27710 60S acidic ribosomal protein f... Potri.009G146200 0 1
AT5G04800 Ribosomal S17 family protein (... Potri.010G241200 1.00 0.9878
AT2G27710 60S acidic ribosomal protein f... Potri.004G185800 1.41 0.9732
AT3G56340 Ribosomal protein S26e family ... Potri.019G057000 3.46 0.9703 RPS26.2
AT3G52590 HAP4, ERD16, UB... HAPLESS 4, EARLY-RESPONSIVE TO... Potri.015G007100 3.87 0.9626 UBQ1.4
AT1G09690 Translation protein SH3-like f... Potri.003G159500 4.00 0.9685 RPL21.1
AT3G02560 Ribosomal protein S7e family p... Potri.004G099200 4.24 0.9715
AT5G02960 Ribosomal protein S12/S23 fami... Potri.016G085800 4.89 0.9693 Pt-RPS23.5
Potri.008G070950 4.89 0.9649
AT2G42740 RPL16A ribosomal protein large subuni... Potri.011G069200 6.63 0.9664 L16.2
AT5G02960 Ribosomal protein S12/S23 fami... Potri.006G131500 7.93 0.9688

Potri.009G146200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.