Potri.009G147000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G21110 245 / 8e-85 G10 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G186600 258 / 3e-90 AT4G21110 239 / 1e-82 G10 family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014385 241 / 2e-83 AT4G21110 271 / 2e-95 G10 family protein (.1)
Lus10035562 237 / 7e-82 AT4G21110 273 / 5e-96 G10 family protein (.1)
Lus10023881 237 / 1e-81 AT4G21110 271 / 3e-95 G10 family protein (.1)
Lus10027728 239 / 1e-75 AT3G10050 787 / 0.0 L-O-methylthreonine resistant 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01125 G10 G10 protein
Representative CDS sequence
>Potri.009G147000.7 pacid=42771131 polypeptide=Potri.009G147000.7.p locus=Potri.009G147000 ID=Potri.009G147000.7.v4.1 annot-version=v4.1
ATGCCGAAAGTGAGGACAAACAGGGTCAAATACCCGGAGGGATGGGAGTTAATCGAGCCTACGCTTCGCGAACTCGATGGGAAGATGAGGGAAGCGGAAC
TTGATCCACATGATGGAAAGAGAAAGTGTGAGGCTCTGTGGCCTATTTTCAAAATCACACATCAAAAGAGCCGATATGTTTATGATCTTTATTATAGAAG
GAGTGAGATATCTAAGGAGCTTTATGAGTTCTGCTTGGACCAAGGTTATGGGGATCGTAACCTAATCGCTAAATGGAAGAAGCCAGGATATGAACGACTG
TGCTGTCTACGCTGCATCCAGCCCAGGGATCACAACTTTGGCACAACTTGTGTGTGCAGGGTTCCCAAGCATTTGAGGGAAGAGAAGGTTGTTGAGTGTG
TGCATTGTGGTTGTGGAGGCTGTGCAAGTGGAGATTGA
AA sequence
>Potri.009G147000.7 pacid=42771131 polypeptide=Potri.009G147000.7.p locus=Potri.009G147000 ID=Potri.009G147000.7.v4.1 annot-version=v4.1
MPKVRTNRVKYPEGWELIEPTLRELDGKMREAELDPHDGKRKCEALWPIFKITHQKSRYVYDLYYRRSEISKELYEFCLDQGYGDRNLIAKWKKPGYERL
CCLRCIQPRDHNFGTTCVCRVPKHLREEKVVECVHCGCGGCASGD

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G21110 G10 family protein (.1) Potri.009G147000 0 1
AT5G59180 NRPB7 DNA-directed RNA polymerase II... Potri.001G377200 1.00 0.9320 RPB19.1
AT2G30000 PHF5-like protein (.1) Potri.001G277700 3.16 0.8373
AT5G51940 NRPE6A, NRPD6A,... RNA polymerase Rpb6 (.1) Potri.015G138800 6.48 0.7836
AT1G71750 HGPT Hypoxanthine-guanine phosphori... Potri.005G198400 8.48 0.8202
AT3G15351 unknown protein Potri.002G142000 9.16 0.8315
AT2G04900 unknown protein Potri.014G164500 11.48 0.7978
AT5G46030 unknown protein Potri.011G097300 11.83 0.8150
AT5G13470 unknown protein Potri.003G203900 15.09 0.8133
AT1G05970 RNA-binding (RRM/RBD/RNP motif... Potri.017G030000 15.29 0.8038
AT1G22140 unknown protein Potri.005G167200 16.06 0.7658

Potri.009G147000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.