Potri.009G148400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G27775 56 / 1e-11 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10043370 39 / 0.0001 AT1G18010 103 / 3e-26 Major facilitator superfamily protein (.1)
PFAM info
Representative CDS sequence
>Potri.009G148400.1 pacid=42771270 polypeptide=Potri.009G148400.1.p locus=Potri.009G148400 ID=Potri.009G148400.1.v4.1 annot-version=v4.1
ATGGCAAATTGGGCAAGTGCAGGGAGGTCTACCTCCAACATAATGCGAGCAGCACTAAGAGCAACAAAAAAATCAGCATCACCAACAGCTAGGGTTTCTG
TTTCTCAATTTTCTTCTCCAATCCGTCTTCCCAATTTGACCCTCCATTGTCACTCCCGCATTTCGTCTTCGAGATTGGTGCGTCGAGAATTGAGCTCGCT
TCTTCCTGTCCACAGCGCCATTGCTTCTGCTTGCCTTGTATCCAAACTCCCAAGCGAAGTCAGCACCTCCTCTGAAGGTAGATTTGCTAATTATATCAGT
CCCATCTAG
AA sequence
>Potri.009G148400.1 pacid=42771270 polypeptide=Potri.009G148400.1.p locus=Potri.009G148400 ID=Potri.009G148400.1.v4.1 annot-version=v4.1
MANWASAGRSTSNIMRAALRATKKSASPTARVSVSQFSSPIRLPNLTLHCHSRISSSRLVRRELSSLLPVHSAIASACLVSKLPSEVSTSSEGRFANYIS
PI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G27775 unknown protein Potri.009G148400 0 1
AT2G29690 ATHANSYNAB, ASA... anthranilate synthase 2 (.1) Potri.009G044300 1.73 0.8511
AT3G18580 Nucleic acid-binding, OB-fold-... Potri.012G058800 2.44 0.8260
AT2G45060 Uncharacterised conserved prot... Potri.014G058700 3.16 0.8095
AT1G56070 LOS1, AT1G56075... LOW EXPRESSION OF OSMOTICALLY ... Potri.007G065600 3.46 0.8285 Pt-LOS1.2
AT4G31120 PRMT5, SKB1 ,AT... PROTEIN ARGININE METHYLTRANSFE... Potri.018G000500 4.00 0.8251
AT5G54810 ATTSB1, TRP2, T... TRYPTOPHAN BIOSYNTHESIS B, TRY... Potri.011G136000 6.24 0.7606
AT4G13850 ATGRP2, GR-RBP2 glycine rich protein 2, glycin... Potri.001G319800 8.66 0.8249
AT5G56680 SYNC1ARATH, SYN... EMBRYO DEFECTIVE 2755, Class I... Potri.006G153900 10.19 0.8192 Pt-SYNC3.1
AT5G26830 Threonyl-tRNA synthetase (.1) Potri.008G145600 10.67 0.7607 THRRS.1
AT5G57120 unknown protein Potri.018G140200 10.90 0.8193

Potri.009G148400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.