Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G27650 137 / 2e-41 C3HZnF ATU2AF35A U2 snRNP auxiliary factor small subunit, putative (.1.2) AT5G42820 131 / 2e-39 C3HZnF ATU2AF35B Zinc finger C-x8-C-x5-C-x3-H type family protein (.1.2) AT3G44785 74 / 3e-19 C3HZnF Zinc finger C-x8-C-x5-C-x3-H type family protein (.1) AT1G10320 59 / 7e-12 C3HZnF Zinc finger C-x8-C-x5-C-x3-H type family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G188900 [exp] 145 / 1e-44 AT5G42820 311 / 4e-106 Zinc finger C-x8-C-x5-C-x3-H type family protein (.1.2) Potri.002G003000 [exp] 133 / 3e-40 AT1G27650 349 / 2e-121 U2 snRNP auxiliary factor small subunit, putative (.1.2) Potri.005G258000 [exp] 132 / 5e-40 AT1G27650 352 / 1e-122 U2 snRNP auxiliary factor small subunit, putative (.1.2) Potri.006G116700 [exp] 133 / 7e-40 AT5G42820 295 / 7e-100 Zinc finger C-x8-C-x5-C-x3-H type family protein (.1.2) Potri.004G228600 [exp] 56 / 9e-11 AT1G10320 462 / 1e-151 Zinc finger C-x8-C-x5-C-x3-H type family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020540 [exp] 143 / 1e-44 AT1G27650 323 / 7e-112 U2 snRNP auxiliary factor small subunit, putative (.1.2) Lus10009389 [exp] 144 / 6e-44 AT5G42820 362 / 3e-126 Zinc finger C-x8-C-x5-C-x3-H type family protein (.1.2) Lus10008648 [exp] 129 / 3e-38 AT5G42820 358 / 6e-125 Zinc finger C-x8-C-x5-C-x3-H type family protein (.1.2) Lus10003375 [exp] 125 / 1e-36 AT5G42820 357 / 3e-124 Zinc finger C-x8-C-x5-C-x3-H type family protein (.1.2) Lus10002845 [exp] 125 / 1e-36 AT5G42820 355 / 1e-123 Zinc finger C-x8-C-x5-C-x3-H type family protein (.1.2) Lus10038139 [exp] 58 / 3e-11 AT1G10320 570 / 0.0 Zinc finger C-x8-C-x5-C-x3-H type family protein (.1) Lus10010687 [exp] 43 / 6e-06 AT1G10320 288 / 9e-88 Zinc finger C-x8-C-x5-C-x3-H type family protein (.1) Lus10002971 [exp] 37 / 0.001 AT3G50620 451 / 2e-160 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.009G149600.2 pacid=42772232 polypeptide=Potri.009G149600.2.p locus=Potri.009G149600 ID=Potri.009G149600.2.v4.1 annot-version=v4.1 ATGGCGGAGCACTTGGCGTCGATATTTGGAACAGAGAAAGACAGAGTGAACTGTCCGTTTTACTTCAAGATCCGAGCTTGTAGACACACCAAACCAAGCA TCAGCCGTACTCTTCTCTTATCAAACATGTACCGGCGTCCTGATATGATCACTCCTGGCGTTGATGCACTGGGTAACACCATCGATCCTCGCAAAATCCA GCAATACTTCGAGGATCTTTATGAGGAGCTAAGCAAATACGGAGAAATTAGAGCTTGA
AA sequence Show only first row Show all	>Potri.009G149600.2 pacid=42772232 polypeptide=Potri.009G149600.2.p locus=Potri.009G149600 ID=Potri.009G149600.2.v4.1 annot-version=v4.1 MAEHLASIFGTEKDRVNCPFYFKIRACRHTKPSISRTLLLSNMYRRPDMITPGVDALGNTIDPRKIQQYFEDLYEELSKYGEIRA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G27650	C3HZnF	ATU2AF35A	U2 snRNP auxiliary factor smal...		Potri.009G149600 [exp]	0	1
AT1G17680			tetratricopeptide repeat (TPR)...		Potri.013G128900 [exp]	2.23	0.8374
AT3G44880		PAO, LLS1, ACD1	LETHAL LEAF-SPOT 1 HOMOLOG, AC...		Potri.009G004100 [exp]	3.46	0.8260
AT5G45290			RING/U-box superfamily protein...		Potri.006G190500 [exp]	5.47	0.7610
AT4G02020		SDG10, SWINGER,...	SWINGER, SET DOMAIN-CONTAINING...		Potri.002G195700 [exp]	5.91	0.7553
AT2G24350			RNA binding (RRM/RBD/RNP motif...		Potri.012G145050 [exp]	8.00	0.8002
AT5G24350			unknown protein		Potri.015G008500 [exp]	8.00	0.8198
AT3G22470			Pentatricopeptide repeat (PPR)...		Potri.019G062332 [exp]	9.79	0.8157
AT1G08060		MOM1, MOM	MORPHEUS MOLECULE 1, MORPHEUS ...		Potri.013G006000 [exp]	12.96	0.8234	MOM.2,1
AT5G16630		ATRAD4	DNA repair protein Rad4 family...		Potri.004G087400 [exp]	13.03	0.7981
AT3G22430			unknown protein		Potri.008G024500 [exp]	14.07	0.7976

Compare expression of checked genes

Potri.009G149600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.