Potri.009G151300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G65620 185 / 6e-54 Zincin-like metalloproteases family protein (.1)
AT5G10540 184 / 9e-54 Zincin-like metalloproteases family protein (.1)
AT1G67690 40 / 0.0009 Zincin-like metalloproteases family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G004600 189 / 1e-55 AT5G65620 1196 / 0.0 Zincin-like metalloproteases family protein (.1)
Potri.014G010100 188 / 7e-55 AT5G65620 1199 / 0.0 Zincin-like metalloproteases family protein (.1)
Potri.010G054466 41 / 0.0006 AT1G67690 850 / 0.0 Zincin-like metalloproteases family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019236 181 / 4e-52 AT5G65620 1073 / 0.0 Zincin-like metalloproteases family protein (.1)
Lus10004276 168 / 1e-47 AT5G10540 1183 / 0.0 Zincin-like metalloproteases family protein (.1)
Lus10037058 42 / 0.0002 AT1G67690 858 / 0.0 Zincin-like metalloproteases family protein (.1)
Lus10036925 42 / 0.0005 AT1G67690 826 / 0.0 Zincin-like metalloproteases family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0126 Peptidase_MA PF01432 Peptidase_M3 Peptidase family M3
Representative CDS sequence
>Potri.009G151300.4 pacid=42772406 polypeptide=Potri.009G151300.4.p locus=Potri.009G151300 ID=Potri.009G151300.4.v4.1 annot-version=v4.1
ATGGCAGCCGATTATCAATACAACAATCCCTTGCTGGAGGACTTCCTCTTTCCTCCTTATGATGCCATCCAGCCCAAGCACGTCTCCCCTGCCATCCTCT
CACTCTTGGACCAGCTTGAGAGTAATTTGGTTGAGTTAGAGACTAGAGGAGAACCAACATGGCCAAAATTGGTGGAACCATTGGAGAAGATTAAAGACAG
ATTATCTGTTGTTTGGGGGATTGTGAACCATCTGAATGCTGTTATGGATTCTCCTGAACTTCGTTCAGCCATCGAAGAAGTCCAGCCAGAGAAGGTAAAG
TTCCAGCTTAGATTGGACCAAAGTAAACCTGTATACACTGCATTTAAAGCCATTCGACAATCTTCTGAATGGGAGAGCTTGAACGAGCTACGATTTGCAA
GTGTGGATTTGGAGCTCCATAAAAATTATATTCCAGGTGGGCTAGAATCTGTCTTTGATATTGATCAAAGAGTGAGTAGAAAGACACAAGTGATGCCCCT
ACAACCAGAGGACAGATTCCTCTGTAGTTTCAGTCACATATTTGCAGATACATATGCAGCTGGTTACTATTGCTACCAGTGGGCAGAGGTATTAGCTGCC
GATGCTTTCTCGGCATTTGAGGAGGCTGGCTTGAATAATGAAAAGGCTGTCAAAGAAACTGGTATCAAGTTTCGAGAAACTGTTCTAGCACTTGGTGGTG
GAAAATCACCCCTCCAGGTCATACCAGTTTAA
AA sequence
>Potri.009G151300.4 pacid=42772406 polypeptide=Potri.009G151300.4.p locus=Potri.009G151300 ID=Potri.009G151300.4.v4.1 annot-version=v4.1
MAADYQYNNPLLEDFLFPPYDAIQPKHVSPAILSLLDQLESNLVELETRGEPTWPKLVEPLEKIKDRLSVVWGIVNHLNAVMDSPELRSAIEEVQPEKVK
FQLRLDQSKPVYTAFKAIRQSSEWESLNELRFASVDLELHKNYIPGGLESVFDIDQRVSRKTQVMPLQPEDRFLCSFSHIFADTYAAGYYCYQWAEVLAA
DAFSAFEEAGLNNEKAVKETGIKFRETVLALGGGKSPLQVIPV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G65620 Zincin-like metalloproteases f... Potri.009G151300 0 1
AT3G52740 unknown protein Potri.009G163900 1.00 0.9706
AT5G17230 PSY PHYTOENE SYNTHASE (.1.2.3) Potri.002G056800 3.74 0.9653
AT5G62680 Major facilitator superfamily ... Potri.012G071500 4.58 0.9485
AT2G05620 PGR5 proton gradient regulation 5 (... Potri.008G171000 5.74 0.9530 PGR5.2
AT1G69490 NAC NAP, ANAC029, A... Arabidopsis NAC domain contain... Potri.010G166200 8.06 0.9392
AT5G24120 ATSIG5, SIG5, S... SIGMA FACTOR 5, sigma factor E... Potri.015G022100 9.00 0.9467
Potri.015G143150 9.38 0.9475
AT1G78510 SPS1 solanesyl diphosphate synthase... Potri.001G380500 9.48 0.9493
AT4G34740 CIA1, ATASE2, A... CHLOROPLAST IMPORT APPARATUS 1... Potri.009G125600 10.00 0.9496
AT5G24120 ATSIG5, SIG5, S... SIGMA FACTOR 5, sigma factor E... Potri.012G031100 10.19 0.9508 Pt-SIGE.3

Potri.009G151300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.