Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G27170 91 / 3e-23 SMC3, TTN7 TITAN7, STRUCTURAL MAINTENANCE OF CHROMOSOMES 3, Structural maintenance of chromosomes (SMC) family protein (.1), Structural maintenance of chromosomes (SMC) family protein (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G155200 [exp] 115 / 7e-32 AT2G27170 1665 / 0.0 TITAN7, STRUCTURAL MAINTENANCE OF CHROMOSOMES 3, Structural maintenance of chromosomes (SMC) family protein (.1), Structural maintenance of chromosomes (SMC) family protein (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036169 [exp] 84 / 1e-20 AT2G27170 1368 / 0.0 TITAN7, STRUCTURAL MAINTENANCE OF CHROMOSOMES 3, Structural maintenance of chromosomes (SMC) family protein (.1), Structural maintenance of chromosomes (SMC) family protein (.2) Lus10017012 [exp] 52 / 1e-09 AT3G26770 139 / 2e-39 NAD(P)-binding Rossmann-fold superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.009G154550.1 pacid=42771875 polypeptide=Potri.009G154550.1.p locus=Potri.009G154550 ID=Potri.009G154550.1.v4.1 annot-version=v4.1 ATGATTCGTCGCCTGGCTGATATGGCAAACACACAATTTATAACCACCACTTTCAGGCCAGAACTTGTGAAGGTTGCTGACAAGTTATATGTGGTGACAC ACAAAAACAGGGTGAGCCGTGTCAATGTTGTCTCCAAGGAAGATGCACTAGATTTTATCGAGCACGACCAAAGAACCGGCGCGAGCATGTGTTCTCGATG A
AA sequence Show only first row Show all	>Potri.009G154550.1 pacid=42771875 polypeptide=Potri.009G154550.1.p locus=Potri.009G154550 ID=Potri.009G154550.1.v4.1 annot-version=v4.1 MIRRLADMANTQFITTTFRPELVKVADKLYVVTHKNRVSRVNVVSKEDALDFIEHDQRTGASMCSR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G27170		SMC3, TTN7	TITAN7, STRUCTURAL MAINTENANCE...		Potri.009G154550 [exp]	0	1
AT3G14470			NB-ARC domain-containing disea...		Potri.013G041800 [exp]	4.47	0.8624
AT2G32950		FUS1, EMB168, D...	FUSCA 1, EMBRYO DEFECTIVE 168,...		Potri.011G021700 [exp]	7.34	0.8439
					Potri.013G064900 [exp]	8.48	0.8663
AT3G07440			unknown protein		Potri.007G083100 [exp]	10.19	0.8448
AT2G20110	CPP		Tesmin/TSO1-like CXC domain-co...		Potri.001G184800 [exp]	22.22	0.7977
AT5G22300		AtNIT4, NIT4	nitrilase 4 (.1)		Potri.016G074200 [exp]	26.53	0.8201
AT1G73120			unknown protein		Potri.010G248600 [exp]	28.28	0.8352
AT1G77210		AtSTP14	sugar transport protein 14, su...		Potri.009G048200 [exp]	37.09	0.8035
AT1G11400		PYM	partner of Y14-MAGO (.1.2.3)		Potri.001G209100 [exp]	39.19	0.7835
AT5G56360		PSL4	PRIORITY IN SWEET LIFE 4, calm...		Potri.001G001700 [exp]	42.00	0.7991

Compare expression of checked genes

Potri.009G154550 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.