Potri.009G154701 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G04885 286 / 7e-94 Glycosyl hydrolase family protein (.1)
AT5G20950 283 / 3e-93 Glycosyl hydrolase family protein (.1.2)
AT5G20940 273 / 5e-89 Glycosyl hydrolase family protein (.1)
AT3G47000 241 / 5e-77 Glycosyl hydrolase family protein (.1)
AT3G47050 229 / 3e-74 Glycosyl hydrolase family protein (.1.2)
AT3G47010 233 / 7e-74 Glycosyl hydrolase family protein (.1.2)
AT3G47040 226 / 7e-71 Glycosyl hydrolase family protein (.1.2)
AT3G62710 218 / 1e-67 Glycosyl hydrolase family protein (.1)
AT5G09730 56 / 2e-09 ATBXL3, XYL3, BXL3, ATBX3 beta-xylosidase 3 (.1)
AT5G64570 55 / 5e-09 ATBXL4, XYL4 ARABIDOPSIS THALIANA BETA-D-XYLOSIDASE 4, beta-D-xylosidase 4 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G013500 316 / 3e-105 AT5G04885 966 / 0.0 Glycosyl hydrolase family protein (.1)
Potri.019G037400 306 / 6e-102 AT5G20950 926 / 0.0 Glycosyl hydrolase family protein (.1.2)
Potri.013G055600 305 / 1e-101 AT5G20950 932 / 0.0 Glycosyl hydrolase family protein (.1.2)
Potri.008G013700 296 / 4e-98 AT5G20950 901 / 0.0 Glycosyl hydrolase family protein (.1.2)
Potri.009G153900 285 / 1e-93 AT5G20950 937 / 0.0 Glycosyl hydrolase family protein (.1.2)
Potri.009G042800 235 / 8e-75 AT3G47000 934 / 0.0 Glycosyl hydrolase family protein (.1)
Potri.009G153966 122 / 3e-36 AT5G20950 109 / 2e-29 Glycosyl hydrolase family protein (.1.2)
Potri.013G055700 64 / 2e-13 AT5G20950 139 / 1e-39 Glycosyl hydrolase family protein (.1.2)
Potri.005G168400 62 / 3e-11 AT1G78060 981 / 0.0 Glycosyl hydrolase family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033393 307 / 5e-102 AT5G04885 964 / 0.0 Glycosyl hydrolase family protein (.1)
Lus10013646 289 / 3e-95 AT5G20950 941 / 0.0 Glycosyl hydrolase family protein (.1.2)
Lus10010656 287 / 1e-94 AT5G20950 897 / 0.0 Glycosyl hydrolase family protein (.1.2)
Lus10001151 286 / 5e-94 AT5G20950 911 / 0.0 Glycosyl hydrolase family protein (.1.2)
Lus10013390 279 / 2e-91 AT5G20950 935 / 0.0 Glycosyl hydrolase family protein (.1.2)
Lus10013388 278 / 5e-91 AT5G04885 801 / 0.0 Glycosyl hydrolase family protein (.1)
Lus10008434 277 / 1e-89 AT5G04885 796 / 0.0 Glycosyl hydrolase family protein (.1)
Lus10010657 270 / 1e-87 AT5G20950 889 / 0.0 Glycosyl hydrolase family protein (.1.2)
Lus10008432 269 / 1e-87 AT5G20950 927 / 0.0 Glycosyl hydrolase family protein (.1.2)
Lus10005706 265 / 7e-86 AT5G04885 863 / 0.0 Glycosyl hydrolase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0058 Glyco_hydro_tim PF00933 Glyco_hydro_3 Glycosyl hydrolase family 3 N terminal domain
Representative CDS sequence
>Potri.009G154701.1 pacid=42770971 polypeptide=Potri.009G154701.1.p locus=Potri.009G154701 ID=Potri.009G154701.1.v4.1 annot-version=v4.1
ATGATTAATGGATTCCAAAATGTTTCACTCTCTAGTCGTCTTGGAATTCCTATGATTTATGGGATTGATGTTGTTCACGGGCACAACAATATTTATAAGG
CCACCATATTCCCTCATAACGTGGGTCCTGGAGCCACAAGGGATCCTGACAGGATTGGAGCAGCAACTGCTCTTGAAGTTAGGGCTACTGGCATTCCTTA
CGTTTTTGCTCCATGCATTGCGATACGTAGTGATCTAAAAGTTTGTAGAGATCCTAGATGGGGTAGGTGCTATGAGAGCTATAGTGAGGATCCTAAAGTT
GTTGAAATGATGACAGAGATTATACCTGGATTGCAAGGTGATGTTCCTCCAGATTCCAGAAAGGGTGTTCCCTATGTTGGTGGAAAGGACAAAGTTCCAG
CCTGTGCGAAGCACTTTGTTGGCGATGGGGGCACCACCAAAGGCATTAACGAGAATAATACTGTTATTGGCTACCATGGATTGATGAGCATTCATATGCC
AAGTTATTTTCACTCCATTATCAAGGGTGTCTCAACTGTTATGGCTTCTTACTCAAGCTAG
AA sequence
>Potri.009G154701.1 pacid=42770971 polypeptide=Potri.009G154701.1.p locus=Potri.009G154701 ID=Potri.009G154701.1.v4.1 annot-version=v4.1
MINGFQNVSLSSRLGIPMIYGIDVVHGHNNIYKATIFPHNVGPGATRDPDRIGAATALEVRATGIPYVFAPCIAIRSDLKVCRDPRWGRCYESYSEDPKV
VEMMTEIIPGLQGDVPPDSRKGVPYVGGKDKVPACAKHFVGDGGTTKGINENNTVIGYHGLMSIHMPSYFHSIIKGVSTVMASYSS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G04885 Glycosyl hydrolase family prot... Potri.009G154701 0 1
AT5G04885 Glycosyl hydrolase family prot... Potri.009G154802 1.41 0.8527
Potri.006G263350 30.29 0.7914
AT3G21420 LBO1 LATERAL BRANCHING OXIDOREDUCTA... Potri.010G200900 34.42 0.7701
AT4G16110 GARP ARR2 response regulator 2 (.1) Potri.010G001000 46.58 0.7714 Pt-ARR5.4
AT1G01490 Heavy metal transport/detoxifi... Potri.003G132200 51.35 0.7860
AT1G17100 SOUL heme-binding family prote... Potri.012G088400 58.99 0.7759
AT5G54590 CRLK1 calcium/calmodulin-regulated r... Potri.004G235700 59.21 0.7612
AT2G44890 CYP704A1 "cytochrome P450, family 704, ... Potri.012G131200 62.04 0.7556
AT1G68450 PDE337 PIGMENT DEFECTIVE 337, VQ moti... Potri.006G199300 71.65 0.7462
AT5G43066 unknown protein Potri.014G022000 74.47 0.7332

Potri.009G154701 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.