Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G06340 85 / 2e-22 Plant Tudor-like protein (.1) AT1G09320 67 / 3e-14 agenet domain-containing protein (.1) AT1G11420 47 / 2e-07 ATDUF2 DOMAIN OF UNKNOWN FUNCTION 724 2 (.1) AT3G06520 47 / 2e-07 agenet domain-containing protein (.1) AT1G26540 44 / 3e-06 Agenet domain-containing protein (.1) AT2G47230 43 / 5e-06 ATDUF6 DOMAIN OF UNKNOWN FUNCTION 724 6 (.1.2) AT5G55600 40 / 7e-05 agenet domain-containing protein / bromo-adjacent homology (BAH) domain-containing protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G151200 [exp] 167 / 5e-55 AT1G06340 141 / 3e-44 Plant Tudor-like protein (.1) Potri.005G011100 [exp] 64 / 3e-13 AT1G09320 264 / 3e-84 agenet domain-containing protein (.1) Potri.013G006900 [exp] 62 / 8e-13 AT1G09320 268 / 1e-85 agenet domain-containing protein (.1) Potri.014G117800 [exp] 56 / 2e-10 AT1G11420 194 / 1e-52 DOMAIN OF UNKNOWN FUNCTION 724 2 (.1) Potri.002G192300 [exp] 55 / 4e-10 AT1G26540 201 / 3e-54 Agenet domain-containing protein (.1) Potri.006G250600 [exp] 37 / 0.0005 AT4G32440 272 / 4e-88 Plant Tudor-like RNA-binding protein (.1.2.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027325 [exp] 89 / 4e-24 AT1G06340 95 / 2e-25 Plant Tudor-like protein (.1) Lus10039027 [exp] 81 / 8e-21 AT1G06340 91 / 7e-24 Plant Tudor-like protein (.1) Lus10009266 [exp] 75 / 7e-18 AT1G06340 86 / 2e-21 Plant Tudor-like protein (.1) Lus10017088 [exp] 62 / 2e-12 AT3G06520 283 / 1e-90 agenet domain-containing protein (.1) Lus10037805 [exp] 58 / 3e-11 AT3G06520 271 / 9e-86 agenet domain-containing protein (.1) Lus10000353 [exp] 52 / 3e-09 AT1G16890 313 / 3e-103 UBIQUITIN CONJUGATING ENZYME 13B, ubiquitin-conjugating enzyme 36 (.1.2.3) Lus10000615 [exp] 50 / 2e-08 AT1G16890 286 / 9e-95 UBIQUITIN CONJUGATING ENZYME 13B, ubiquitin-conjugating enzyme 36 (.1.2.3) Lus10010903 [exp] 49 / 7e-08 AT1G09320 136 / 3e-35 agenet domain-containing protein (.1) Lus10002437 [exp] 44 / 2e-06 AT3G62300 252 / 1e-73 DOMAIN OF UNKNOWN FUNCTION 724 7 (.1.2) Lus10031429 [exp] 44 / 3e-06 AT1G09320 131 / 2e-33 agenet domain-containing protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.009G155250.1 pacid=42771708 polypeptide=Potri.009G155250.1.p locus=Potri.009G155250 ID=Potri.009G155250.1.v4.1 annot-version=v4.1 ATGTCAAAGCTACTGATAGAGACAGTTTCTGCTGATGAGGTGAGGCCAGTGCCACTGAGAATCAAATTTGGAAGCGGGCTTTCTATGTTTGATAAGGTTG ACGCTTTTGACAATGATGGGTGGTGGGTTGGCAAGGTTACTGGACAGAGAGGGCCTCTGTATTTTGTCTTCTCTGAGACAACAGGGGATGAGATAGCTTA CCATGTCTCAAGATTGAGGATTCACTTGGATTGGGTTAATGGCAAGTGGGTTTCTTCAAAAAAAAGATGGTTTCTTCAAAAAAGATAG
AA sequence Show only first row Show all	>Potri.009G155250.1 pacid=42771708 polypeptide=Potri.009G155250.1.p locus=Potri.009G155250 ID=Potri.009G155250.1.v4.1 annot-version=v4.1 MSKLLIETVSADEVRPVPLRIKFGSGLSMFDKVDAFDNDGWWVGKVTGQRGPLYFVFSETTGDEIAYHVSRLRIHLDWVNGKWVSSKKRWFLQKR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G06340			Plant Tudor-like protein (.1)		Potri.009G155250 [exp]	0	1
AT4G01790			Ribosomal protein L7Ae/L30e/S1...		Potri.014G112200 [exp]	27.49	0.6229
AT1G73940			unknown protein		Potri.001G453400 [exp]	28.74	0.6556
AT3G29230			Tetratricopeptide repeat (TPR)...		Potri.012G140400 [exp]	41.89	0.6507
AT1G57540			unknown protein		Potri.005G002900 [exp]	41.95	0.6540
AT3G17300		EMB2786	unknown protein		Potri.008G100400 [exp]	55.22	0.5966
AT2G30920		ATCOQ3, EMB3002	embryo defective 3002, coenzym...		Potri.014G093100 [exp]	122.90	0.5516
AT1G25682			Family of unknown function (DU...		Potri.010G130300 [exp]	123.28	0.5538
AT3G22470			Pentatricopeptide repeat (PPR)...		Potri.007G068400 [exp]	156.09	0.5697
					Potri.019G016120 [exp]	167.04	0.5654
AT4G10130			DNAJ heat shock N-terminal dom...		Potri.014G032000 [exp]	168.69	0.5452

Compare expression of checked genes

Potri.009G155250 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.