Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G43720 107 / 2e-29 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT2G27130 102 / 1e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G14815 65 / 2e-13 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G22600 65 / 3e-13 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G64080 64 / 5e-13 AtXYP1 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT2G13820 62 / 4e-12 AtXYP2 xylogen protein 2, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT4G08670 62 / 6e-12 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G48130 58 / 1e-10 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G03103 56 / 7e-10 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G09370 51 / 3e-08 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G196000 [exp] 172 / 3e-54 AT3G43720 94 / 1e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.010G085400 [exp] 64 / 5e-13 AT3G22600 140 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.003G020200 [exp] 63 / 1e-12 AT5G64080 121 / 5e-35 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.008G155100 [exp] 63 / 2e-12 AT3G22600 149 / 2e-46 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.002G050400 [exp] 57 / 2e-10 AT3G22600 100 / 1e-26 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G210100 [exp] 57 / 3e-10 AT5G64080 118 / 7e-34 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.005G211800 [exp] 54 / 4e-09 AT3G22600 160 / 6e-51 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.002G050500 [exp] 50 / 7e-08 AT3G22600 129 / 2e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.005G211900 [exp] 49 / 2e-07 AT2G48130 89 / 3e-22 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001153 [exp] 107 / 5e-29 AT3G43720 105 / 1e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10026768 [exp] 84 / 9e-21 AT2G27130 81 / 4e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10008400 [exp] 81 / 1e-19 AT3G43720 76 / 6e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10026769 [exp] 79 / 2e-18 AT3G43720 93 / 1e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10008401 [exp] 78 / 6e-18 AT3G43720 91 / 1e-22 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10014681 [exp] 77 / 2e-17 AT3G22600 126 / 3e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10021912 [exp] 73 / 4e-16 AT3G22600 125 / 7e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10041197 [exp] 72 / 1e-15 AT3G22600 117 / 9e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10010572 [exp] 69 / 1e-14 AT3G22600 162 / 2e-51 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10039348 [exp] 68 / 2e-14 AT3G22600 163 / 7e-52 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [poplar] [flax] Prolamin PF14368 [poplar] [flax] LTP_2 Probable lipid transfer
Representative CDS sequence Show only first row Show all	>Potri.009G158100.2 pacid=42771122 polypeptide=Potri.009G158100.2.p locus=Potri.009G158100 ID=Potri.009G158100.2.v4.1 annot-version=v4.1 ATGTCGAAACTAGCGATCACCACCATATTTCTCACCCTAACCATCTTTTCAACAGTGCCAGCAAAAACGTCAGGAGCCACGGCTCCGGTGGCAGCACCTG CACCCGTTTCAGGTGATCTTGCTCCGGCAGCTCCCGGACCAACAGCAGTCAATGAATGTTTAACTCCATTGTTGAACATGTCTGATTGCTTGGGGTATGT AACACAAGGAAGTAACTTGACAGTCCCTGACAAGAATTGCTGTCCTGAGCTTGCCGGGCTGATAGATAGCAACATTATATGTTTGTGTCAGTTGCTTGGT GGTGATATTGCTGAGCAATTTGGGATCTCACTTGATAAGGGAAGAGCTCTCAAGCTTCCTGCAACTTGCAAGATTGATGCTCCTTCAGCCACCTTGTGCT CGGCTGTGGGATACCCAGTACAAGCTCCAGCAAGCGGTCCATCAACAGGCTCAACACCTCAAGGTCCATCTCCATCAACTGGAGATAATAAAGAGAGCGT TGCTTCAAGCATTGCTGGCTCAGCTTATGCAATCTTCGGCGGCTTAGCATCTTCATTTCTCCTAACATTGTTCTGA
AA sequence Show only first row Show all	>Potri.009G158100.2 pacid=42771122 polypeptide=Potri.009G158100.2.p locus=Potri.009G158100 ID=Potri.009G158100.2.v4.1 annot-version=v4.1 MSKLAITTIFLTLTIFSTVPAKTSGATAPVAAPAPVSGDLAPAAPGPTAVNECLTPLLNMSDCLGYVTQGSNLTVPDKNCCPELAGLIDSNIICLCQLLG GDIAEQFGISLDKGRALKLPATCKIDAPSATLCSAVGYPVQAPASGPSTGSTPQGPSPSTGDNKESVASSIAGSAYAIFGGLASSFLLTLF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G43720			Bifunctional inhibitor/lipid-t...		Potri.009G158100 [exp]	0	1
AT4G37630		CYCD5;1	cyclin d5;1 (.1.2)		Potri.007G055300 [exp]	1.00	0.9107	CYCD5.1
AT3G45070			P-loop containing nucleoside t...		Potri.010G138400 [exp]	3.46	0.8918
AT2G26640		KCS11	3-ketoacyl-CoA synthase 11 (.1...		Potri.008G160000 [exp]	4.47	0.8969
AT1G16060	AP2_ERF	ADAP	ARIA-interacting double AP2 do...		Potri.001G041500 [exp]	4.47	0.8861
AT5G20950			Glycosyl hydrolase family prot...		Potri.019G037400 [exp]	6.32	0.8549
AT1G01120		KCS1	3-ketoacyl-CoA synthase 1 (.1)		Potri.002G178000 [exp]	6.92	0.8741	Pt-KCS1.1
AT5G12970			Calcium-dependent lipid-bindin...		Potri.003G210801 [exp]	7.93	0.8643
AT2G43360		BIOB, BIO2	BIOTIN AUXOTROPH B, BIOTIN AUX...		Potri.007G126400 [exp]	8.60	0.7984	BIO2.1
AT5G41040			HXXXD-type acyl-transferase fa...		Potri.015G100800 [exp]	9.94	0.8523
AT5G44130		FLA13	FASCICLIN-like arabinogalactan...		Potri.019G093300 [exp]	9.94	0.8561	2,Pt-FLA9.2

Compare expression of checked genes

Potri.009G158100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.