Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G27060 213 / 4e-64 Leucine-rich repeat protein kinase family protein (.1) AT4G20940 172 / 7e-50 Leucine-rich receptor-like protein kinase family protein (.1) AT5G10020 169 / 1e-48 Leucine-rich receptor-like protein kinase family protein (.1.2) AT3G56100 100 / 1e-24 IMK3, MRLK meristematic receptor-like kinase (.1) AT3G51740 94 / 3e-22 IMK2 inflorescence meristem receptor-like kinase 2 (.1) AT4G34500 90 / 4e-21 Protein kinase superfamily protein (.1) AT2G26730 89 / 1e-20 Leucine-rich repeat protein kinase family protein (.1) AT4G02630 86 / 2e-19 Protein kinase superfamily protein (.1) AT5G20690 83 / 2e-18 Leucine-rich repeat protein kinase family protein (.1) AT1G48480 82 / 2e-18 RKL1 receptor-like kinase 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G197500 [exp] 323 / 5e-105 AT2G27060 1053 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.011G163700 [exp] 198 / 9e-59 AT4G20940 946 / 0.0 Leucine-rich receptor-like protein kinase family protein (.1) Potri.001G465800 [exp] 193 / 5e-57 AT4G20940 915 / 0.0 Leucine-rich receptor-like protein kinase family protein (.1) Potri.005G083000 [exp] 184 / 4e-54 AT5G10020 1140 / 0.0 Leucine-rich receptor-like protein kinase family protein (.1.2) Potri.007G082800 [exp] 176 / 5e-51 AT5G10020 1132 / 0.0 Leucine-rich receptor-like protein kinase family protein (.1.2) Potri.010G183400 [exp] 102 / 2e-25 AT3G51740 903 / 0.0 inflorescence meristem receptor-like kinase 2 (.1) Potri.016G126300 [exp] 101 / 5e-25 AT3G51740 1038 / 0.0 inflorescence meristem receptor-like kinase 2 (.1) Potri.006G104300 [exp] 96 / 5e-23 AT3G51740 996 / 0.0 inflorescence meristem receptor-like kinase 2 (.1) Potri.018G074300 [exp] 89 / 8e-21 AT2G26730 550 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026756 [exp] 239 / 1e-73 AT2G27060 961 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10025541 [exp] 238 / 4e-73 AT2G27060 958 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10038544 [exp] 194 / 3e-57 AT4G20940 1035 / 0.0 Leucine-rich receptor-like protein kinase family protein (.1) Lus10023260 [exp] 192 / 1e-56 AT4G20940 704 / 0.0 Leucine-rich receptor-like protein kinase family protein (.1) Lus10012225 [exp] 100 / 3e-24 AT3G51740 679 / 0.0 inflorescence meristem receptor-like kinase 2 (.1) Lus10022679 [exp] 94 / 2e-22 AT3G51740 926 / 0.0 inflorescence meristem receptor-like kinase 2 (.1) Lus10014236 [exp] 94 / 3e-22 AT3G51740 907 / 0.0 inflorescence meristem receptor-like kinase 2 (.1) Lus10022678 [exp] 93 / 7e-22 AT3G51740 885 / 0.0 inflorescence meristem receptor-like kinase 2 (.1) Lus10014235 [exp] 92 / 1e-21 AT3G51740 933 / 0.0 inflorescence meristem receptor-like kinase 2 (.1) Lus10010973 [exp] 87 / 7e-20 AT1G48480 621 / 0.0 receptor-like kinase 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [poplar] [flax] PKinase PF07714 [poplar] [flax] PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase
Representative CDS sequence Show only first row Show all	>Potri.009G159101.1 pacid=42772277 polypeptide=Potri.009G159101.1.p locus=Potri.009G159101 ID=Potri.009G159101.1.v4.1 annot-version=v4.1 ATGAAACTTCGGTCTTTATCCCTTGATGATCGGCTAAGGATTGCTGTTAATGTCGCCTGGTGTCTAAACTACCTCCACAATGAAAGAGCAATTCCCCATG GAAATCTCAAATCCACAAACATTTTATTAGAGCCTCCAAACATGAATCCACTGCTCACTGACTACAGTCTCCATCGAATATTGACATCGGCTGGCACAGC AGAACAAGTTCTGAATGCAGGTGCTCTTGGCTATCGGCCACCTGAATTTGCTAGTTCAACTAAACCCTGCCCGTCATTGAGCAGTGATGTTTATGCATTC GGGGTTATCTTGTTAGAGCTCCTAACTGGAAAAGGTTCACCGGAGATAGTTTCTGCAGACCCAGGAGTGGTTGATCTGACCGACTGGGAGAGGCTATTGT CTGAAGAGAACCGTTCTAGTGAGTGCTTCGATAAGCTGCTTATGGATACCCCTAATGTGAAGGCACCCAGAGTTCTTGATGAAATGCTCCAGGTGGCTCT TAGATGTATCCTACCAGCATCTGAAAGGCCTGACATGAAAACAGTATTTGAAGATCTTTCAACAGTAGCATTATGA
AA sequence Show only first row Show all	>Potri.009G159101.1 pacid=42772277 polypeptide=Potri.009G159101.1.p locus=Potri.009G159101 ID=Potri.009G159101.1.v4.1 annot-version=v4.1 MKLRSLSLDDRLRIAVNVAWCLNYLHNERAIPHGNLKSTNILLEPPNMNPLLTDYSLHRILTSAGTAEQVLNAGALGYRPPEFASSTKPCPSLSSDVYAF GVILLELLTGKGSPEIVSADPGVVDLTDWERLLSEENRSSECFDKLLMDTPNVKAPRVLDEMLQVALRCILPASERPDMKTVFEDLSTVAL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G27060			Leucine-rich repeat protein ki...		Potri.009G159101 [exp]	0	1
AT1G67410			Exostosin family protein (.1)		Potri.008G034500 [exp]	2.44	0.9123
AT3G56250			unknown protein		Potri.013G083700 [exp]	4.89	0.9008
AT1G32100		ATPRR1	pinoresinol reductase 1 (.1)		Potri.001G133300 [exp]	6.32	0.8468	PCBERp4
AT1G62930		RPF3	RNA processing factor 3, Tetra...		Potri.006G257300 [exp]	8.06	0.8329
AT3G57690		AGP23, ATAGP23	ARABINOGALACTAN-PROTEIN 23, ar...		Potri.016G052001 [exp]	9.00	0.8502
AT1G16290			unknown protein		Potri.008G084100 [exp]	9.16	0.8590
AT3G23090			TPX2 (targeting protein for Xk...		Potri.008G162800 [exp]	10.00	0.8633
AT5G64390		HEN4	HUA ENHANCER 4, RNA-binding KH...		Potri.007G116300 [exp]	10.19	0.8529
AT3G17900			unknown protein		Potri.008G194632 [exp]	11.48	0.8452
AT3G12955			SAUR-like auxin-responsive pro...		Potri.011G143400 [exp]	13.85	0.8594	SAUR5

Compare expression of checked genes

Potri.009G159101 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.