Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-ATGB2.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G35860 412 / 6e-149 ATGB2, AtRABB1b, Atrab2C GTP-binding 2 (.1.2) AT4G17170 382 / 5e-137 ATRAB-B1B, AT-RAB2, AtRABB1c, AtRab2A ARABIDOPSIS RAB GTPASE HOMOLOG B1B, RAB GTPase homolog B1C (.1) AT4G17160 312 / 2e-109 AtRab2B, AtRABB1a RAB GTPase homolog B1A (.1) AT1G06400 204 / 2e-66 ARA2, AtRABA1a, AtRab11E, Ara-2 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A1A, Ras-related small GTP-binding family protein (.1) AT5G45750 203 / 2e-66 AtRABA1c RAB GTPase homolog A1C (.1) AT1G07410 196 / 2e-63 ATRAB-A2B, AtRABA2b ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) AT5G60860 196 / 2e-63 AtRABA1f RAB GTPase homolog A1F (.1) AT1G02130 194 / 7e-63 ARA5, AtRABD2a, AtRab1B, Ara-5 ARABIDOPSIS THALIANA RAB D2A, ARABIDOPSIS THALIANA RESPONSIVE TO ABSCISIC ACID 1B, ARABIDOPSIS RAS 5, RAS 5 (.1) AT3G09900 194 / 9e-63 AtRABE1e, AtRab8E RAB GTPase homolog E1E (.1) AT4G18430 194 / 1e-62 AtRABA1e RAB GTPase homolog A1E (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G002200 [exp] 382 / 5e-137 AT4G17170 394 / 6e-142 ARABIDOPSIS RAB GTPASE HOMOLOG B1B, RAB GTPase homolog B1C (.1) Potri.011G070300 [exp] 202 / 7e-66 AT5G45750 392 / 1e-140 RAB GTPase homolog A1C (.1) Potri.004G061000 [exp] 200 / 6e-65 AT4G18800 392 / 9e-141 RAB GTPase homolog A1D (.1) Potri.011G061300 [exp] 197 / 4e-64 AT5G60860 416 / 5e-150 RAB GTPase homolog A1F (.1) Potri.003G081800 [exp] 197 / 4e-64 AT1G02130 391 / 9e-141 ARABIDOPSIS THALIANA RAB D2A, ARABIDOPSIS THALIANA RESPONSIVE TO ABSCISIC ACID 1B, ARABIDOPSIS RAS 5, RAS 5 (.1) Potri.013G123600 [exp] 196 / 1e-63 AT5G60860 419 / 2e-151 RAB GTPase homolog A1F (.1) Potri.008G051700 [exp] 196 / 2e-63 AT3G46060 329 / 7e-116 RAB GTPase homolog 8A (.1.2.3) Potri.019G092500 [exp] 196 / 2e-63 AT5G60860 419 / 2e-151 RAB GTPase homolog A1F (.1) Potri.010G208900 [exp] 194 / 7e-63 AT3G46060 349 / 5e-124 RAB GTPase homolog 8A (.1.2.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038744 [exp] 381 / 1e-136 AT4G17170 434 / 2e-157 ARABIDOPSIS RAB GTPASE HOMOLOG B1B, RAB GTPase homolog B1C (.1) Lus10039114 [exp] 356 / 8e-127 AT4G17170 407 / 5e-147 ARABIDOPSIS RAB GTPASE HOMOLOG B1B, RAB GTPase homolog B1C (.1) Lus10025184 [exp] 355 / 4e-126 AT4G17170 389 / 1e-139 ARABIDOPSIS RAB GTPASE HOMOLOG B1B, RAB GTPase homolog B1C (.1) Lus10016066 [exp] 342 / 1e-120 AT4G17170 369 / 3e-131 ARABIDOPSIS RAB GTPASE HOMOLOG B1B, RAB GTPase homolog B1C (.1) Lus10020746 [exp] 204 / 9e-67 AT1G06400 375 / 3e-134 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A1A, Ras-related small GTP-binding family protein (.1) Lus10029253 [exp] 204 / 2e-66 AT5G45750 393 / 4e-141 RAB GTPase homolog A1C (.1) Lus10029789 [exp] 202 / 6e-66 AT1G06400 373 / 3e-133 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A1A, Ras-related small GTP-binding family protein (.1) Lus10007306 [exp] 201 / 2e-65 AT5G45750 387 / 5e-139 RAB GTPase homolog A1C (.1) Lus10025432 [exp] 199 / 2e-64 AT5G60860 422 / 1e-152 RAB GTPase homolog A1F (.1) Lus10015297 [exp] 199 / 2e-64 AT5G60860 428 / 6e-155 RAB GTPase homolog A1F (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF00025 [poplar] [flax] Arf ADP-ribosylation factor family
Representative CDS sequence Show only first row Show all	>Potri.009G159600.2 pacid=42771475 polypeptide=Potri.009G159600.2.p locus=Potri.009G159600 ID=Potri.009G159600.2.v4.1 annot-version=v4.1 ATGTCTTACGATTACCTCTTCAAGTACATAATCATCGGTGATACAGGCGTAGGGAAGTCATGCCTGCTCTTGCAATTCACTGACAAAAGATTCCAGCCTG TTCATGATCTCACCATCGGTGTTGAATTCGGAGCTCGCATGGTCACCATCGATGCCCGCCCTATTAAGCTTCAAATTTGGGACACCGCTGGGCAAGAGTC CTTCAGATCCATCACTAGATCTTACTACAGAGGAGCAGCCGGAGCACTTCTGGTTTATGACATTACCAGGAGAGAGACGTTTAATCACCTAGCAAGCTGG CTGGAGGATGCTCGGCAGCATGCAAATCCCAACATGTCAATTATGCTTATTGGGAACAAGTGTGATCTTGCTCATCGTAGGGCTGTTAGCAAAGAGGAAG GGGAACAGTTTGCAAAAGAAAATGGACTTCTGTTCTTGGAGGCATCTGCAAGAACAGCTCAAAATGTTGAGGAGGCCTTCATAGGGACTGCTGGAAAAAT CCTTCAGAATATCCAGGAAGGTGTGTTTGATGTATCCAATGAGTCTTCAGGGATCAAGGTTGGATATGGGCGCCCCCAAGGTGCATCAGGTGCAAGGGAT GGAACTGTTGCTCAAAGAGGGGGGTGCTGCAGCTAA
AA sequence Show only first row Show all	>Potri.009G159600.2 pacid=42771475 polypeptide=Potri.009G159600.2.p locus=Potri.009G159600 ID=Potri.009G159600.2.v4.1 annot-version=v4.1 MSYDYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVTIDARPIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRETFNHLASW LEDARQHANPNMSIMLIGNKCDLAHRRAVSKEEGEQFAKENGLLFLEASARTAQNVEEAFIGTAGKILQNIQEGVFDVSNESSGIKVGYGRPQGASGARD GTVAQRGGCCS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G35860		ATGB2, AtRABB1b...	GTP-binding 2 (.1.2)		Potri.009G159600 [exp]	0	1	Pt-ATGB2.1
AT4G29160		SNF7.1	SNF7 family protein (.1.2.3)		Potri.018G069900 [exp]	1.00	0.8072
AT5G25760		PEX4, UBC21	ubiquitin-conjugating enzyme 2...		Potri.006G240900 [exp]	3.46	0.7136
AT5G40670			PQ-loop repeat family protein ...		Potri.017G070300 [exp]	3.46	0.7205
AT2G40810		ATATG18C	homolog of yeast autophagy 18C...		Potri.019G062800 [exp]	3.46	0.7019
AT1G12350		ATCOAB	4-phospho-panto-thenoylcystein...		Potri.002G090500 [exp]	4.24	0.6893
AT2G02040		NTR1, ATPTR2-B	NITRATE TRANSPORTER 1, ARABIDO...		Potri.010G100200 [exp]	5.91	0.7072	NTR1.3
AT4G16144		AMSH3	associated molecule with the S...		Potri.010G141100 [exp]	6.92	0.6926
AT3G48890		MSBP2, ATMP2, A...	MEMBRANE STEROID BINDING PROTE...		Potri.015G139800 [exp]	7.74	0.6836	MP2.3
AT5G16880			Target of Myb protein 1 (.1.2....		Potri.019G050000 [exp]	9.16	0.6777
AT5G04270			DHHC-type zinc finger family p...		Potri.010G226100 [exp]	9.79	0.6542

Compare expression of checked genes

Potri.009G159600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.