Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G15733 57 / 3e-12 SCRL11 SCR-like 11 (.1) AT4G22115 51 / 5e-10 SCRL14 SCR-like 14 (.1) AT2G05117 50 / 1e-09 SCRL9 SCR-like 9 (.1) AT4G15735 50 / 3e-09 SCRL10 SCR-like 10 (.1) AT4G22105 45 / 7e-08 SCRL26 SCR-like 26 (.1) AT1G65113 38 / 5e-05 SCRL2 SCR-like 2 (.1) AT1G08695 37 / 0.0001 SCRL3 SCR-like 3 (.1) AT1G60986 37 / 0.0001 SCRL4 SCR-like 4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G201100 [exp] 96 / 7e-28 AT4G15733 50 / 8e-10 SCR-like 11 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042791 [exp] 81 / 1e-21 AT4G15733 65 / 2e-15 SCR-like 11 (.1) Lus10033371 [exp] 80 / 2e-21 AT4G15733 71 / 6e-18 SCR-like 11 (.1) Lus10029762 [exp] 75 / 1e-19 AT4G15733 60 / 1e-13 SCR-like 11 (.1) Lus10034823 [exp] 72 / 2e-17 AT4G15733 66 / 7e-15 SCR-like 11 (.1) Lus10033373 [exp] 71 / 2e-16 ND 64 / 3e-13 Lus10034824 [exp] 68 / 4e-16 AT4G15733 63 / 9e-14 SCR-like 11 (.1) Lus10010504 [exp] 58 / 8e-13 AT4G22115 42 / 1e-06 SCR-like 14 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0054 [poplar] [flax] Knottin_1 PF06876 [poplar] [flax] SCRL Plant self-incompatibility response (SCRL) protein
Representative CDS sequence Show only first row Show all	>Potri.009G162300.1 pacid=42771337 polypeptide=Potri.009G162300.1.p locus=Potri.009G162300 ID=Potri.009G162300.1.v4.1 annot-version=v4.1 ATGAAGCTAATTGTCTTTCTCTTGATTTCTTGGGTCGCACTATTAAGCCTCTTCACTCCCACTCAAGGTCAAATCAAATGGTGCCCAAAGACGGCCAGAT TTCCAGGGGGGTGTGGAAACAACGGCAGTCAGCAATGCTTAGTTGATTTTTTATCAAACTATGGTGCAAGCAGCATGCCAAAGAATTGTGTATGCAAAAA TGCAGGATCTCAACGACTGTGCTCATGTGACGTTGTTTGTCAGTAA
AA sequence Show only first row Show all	>Potri.009G162300.1 pacid=42771337 polypeptide=Potri.009G162300.1.p locus=Potri.009G162300 ID=Potri.009G162300.1.v4.1 annot-version=v4.1 MKLIVFLLISWVALLSLFTPTQGQIKWCPKTARFPGGCGNNGSQQCLVDFLSNYGASSMPKNCVCKNAGSQRLCSCDVVCQ

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G15733		SCRL11	SCR-like 11 (.1)		Potri.009G162300 [exp]	0	1
					Potri.003G044301 [exp]	2.82	0.8368
					Potri.005G201350 [exp]	3.16	0.8342
AT3G46640	GARP	PCL1, LUX	PHYTOCLOCK 1, LUX ARRHYTHMO, H...		Potri.009G035000 [exp]	11.31	0.8068
AT4G27290			S-locus lectin protein kinase ...		Potri.011G128700 [exp]	16.24	0.7836
AT1G76890	Trihelix	AT-GT2, GT2	Duplicated homeodomain-like su...		Potri.005G192000 [exp]	17.14	0.8075
					Potri.014G023301 [exp]	20.12	0.7593
AT2G20180	bHLH	PIF1, PIL5, bHL...	PHY-INTERACTING FACTOR 1, phyt...		Potri.002G252800 [exp]	23.21	0.7886	Pt-PIL5.1
AT3G14270		FAB1B	FORMS APLOID AND BINUCLEATE CE...		Potri.001G163200 [exp]	25.00	0.7430
AT2G35800		SAMTL	S-adenosyl methionine transpor...		Potri.008G043700 [exp]	30.82	0.7515
AT4G27220			NB-ARC domain-containing disea...		Potri.005G042400 [exp]	31.17	0.7382

Compare expression of checked genes

Potri.009G162300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.