Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G50360 53 / 4e-09 CEN1, ATCEN2 CENTRIN 1, centrin2 (.1) AT4G04740 53 / 2e-08 CPK23, ATCPK23 calcium-dependent protein kinase 23 (.1.2) AT4G04700 50 / 1e-07 CPK27 calcium-dependent protein kinase 27 (.1) AT4G04695 50 / 1e-07 CPK31 calcium-dependent protein kinase 31 (.1) AT1G50700 50 / 1e-07 CPK33 calcium-dependent protein kinase 33 (.1) AT5G12180 50 / 1e-07 CPK17 calcium-dependent protein kinase 17 (.1) AT5G19360 50 / 2e-07 CPK34 calcium-dependent protein kinase 34 (.1) AT4G04720 49 / 3e-07 CPK21 calcium-dependent protein kinase 21 (.1) AT3G50770 46 / 2e-06 CML41 calmodulin-like 41 (.1) AT4G21940 46 / 3e-06 CPK15 calcium-dependent protein kinase 15 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G204700 [exp] 322 / 1e-114 AT5G12180 61 / 2e-11 calcium-dependent protein kinase 17 (.1) Potri.010G244800 [exp] 56 / 1e-09 AT5G04870 899 / 0.0 calcium dependent protein kinase 1 (.1) Potri.009G069200 [exp] 54 / 1e-08 AT5G12180 914 / 0.0 calcium-dependent protein kinase 17 (.1) Potri.002G017000 [exp] 51 / 6e-08 AT1G76040 758 / 0.0 calcium-dependent protein kinase 29 (.1.2) Potri.006G101300 [exp] 50 / 1e-07 AT3G51850 977 / 0.0 calcium-dependent protein kinase 13 (.1) Potri.003G134000 [exp] 50 / 2e-07 AT4G23650 776 / 0.0 Calcium dependent protein kinase 3, calcium-dependent protein kinase 6 (.1) Potri.001G097400 [exp] 50 / 2e-07 AT4G23650 781 / 0.0 Calcium dependent protein kinase 3, calcium-dependent protein kinase 6 (.1) Potri.011G003400 [exp] 49 / 4e-07 AT4G04720 815 / 0.0 calcium-dependent protein kinase 21 (.1) Potri.005G138000 [exp] 47 / 6e-07 AT3G50360 275 / 4e-96 CENTRIN 1, centrin2 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022624 [exp] 290 / 7e-102 AT4G04740 53 / 1e-08 calcium-dependent protein kinase 23 (.1.2) Lus10003320 [exp] 289 / 4e-101 AT3G50360 54 / 1e-08 CENTRIN 1, centrin2 (.1) Lus10002075 [exp] 58 / 2e-10 AT4G04720 536 / 0.0 calcium-dependent protein kinase 21 (.1) Lus10006777 [exp] 54 / 6e-09 AT4G04720 764 / 0.0 calcium-dependent protein kinase 21 (.1) Lus10020046 [exp] 54 / 1e-08 AT4G04720 764 / 0.0 calcium-dependent protein kinase 21 (.1) Lus10021248 [exp] 54 / 1e-08 AT3G10660 809 / 0.0 calmodulin-domain protein kinase cdpk isoform 2 (.1) Lus10012285 [exp] 54 / 1e-08 AT2G38910 884 / 0.0 calcium-dependent protein kinase 20 (.1) Lus10015992 [exp] 54 / 1e-08 AT2G38910 880 / 0.0 calcium-dependent protein kinase 20 (.1) Lus10013603 [exp] 52 / 3e-08 AT3G10660 803 / 0.0 calmodulin-domain protein kinase cdpk isoform 2 (.1) Lus10016200 [exp] 51 / 7e-08 AT2G38910 868 / 0.0 calcium-dependent protein kinase 20 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0220 [poplar] [flax] EF_hand PF13833 [poplar] [flax] EF-hand_8 EF-hand domain pair
Representative CDS sequence Show only first row Show all	>Potri.009G165700.1 pacid=42772442 polypeptide=Potri.009G165700.1.p locus=Potri.009G165700 ID=Potri.009G165700.1.v4.1 annot-version=v4.1 ATGGAGAACACGAGTATGCTAAGAGAATGGTTCGAGCGAGTTGACTCTGAGAAAACTGGAAACATCACTGCAATTCAGCTCAAGAGTGCCCTTGCTGTTG GTAATCTTGAATTCCCTCTCTCTGTTGTCCAGCAAATGATCAGGATGTATGATTTTGATAGGAATGGAACTATGAGTTTTGATGAATTTGTTGGGCTTAA TAAGTTCCTTTTAAAGGTTCAACAAGCTTTCTCGGATCTCGAGAGGGGCCTTGGATATCTTGTTCCTGATGATGTCTACAAGGGATTGGTGAAGATTGGT TTCTCATTGGACTCTCCTTCTTTTTACACAGTTTGTGAGAGCTTTGACCAAAAGAAGAATGGAAAAATTCGTCTAGATGACTTCATATGTCTCTGCATCT TTGTACAGTCTGCTCGGAATCTTTTTAATTCATTTGATACTACAAAGCAAGGCAGAGTTACTCTTGATTTCAATCAGTTGGTGTACTGTACTGCAAATTG TAGAATATGA
AA sequence Show only first row Show all	>Potri.009G165700.1 pacid=42772442 polypeptide=Potri.009G165700.1.p locus=Potri.009G165700 ID=Potri.009G165700.1.v4.1 annot-version=v4.1 MENTSMLREWFERVDSEKTGNITAIQLKSALAVGNLEFPLSVVQQMIRMYDFDRNGTMSFDEFVGLNKFLLKVQQAFSDLERGLGYLVPDDVYKGLVKIG FSLDSPSFYTVCESFDQKKNGKIRLDDFICLCIFVQSARNLFNSFDTTKQGRVTLDFNQLVYCTANCRI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G04870		AK1, ATCPK1, CP...	calcium dependent protein kina...		Potri.009G165700 [exp]	0	1
AT4G10330			glycine-rich protein (.1)		Potri.019G063300 [exp]	2.00	0.7362
AT5G05610	Alfin	AL1	alfin-like 1 (.1.2)		Potri.006G100900 [exp]	4.47	0.6799
AT3G47810		ATVPS29, MAG1	VACUOLAR PROTEIN SORTING 29, M...		Potri.001G354000 [exp]	5.47	0.7259
AT3G27020		YSL6	YELLOW STRIPE like 6 (.1)		Potri.001G327300 [exp]	7.07	0.6750
AT1G75250	MYB	RSM3, ATRL6	RADIALIS-LIKE SANT/MYB 3, RAD-...		Potri.014G113900 [exp]	7.93	0.6641
AT2G34450			HMG-box (high mobility group) ...		Potri.004G131400 [exp]	17.02	0.6102
AT2G28370			Uncharacterised protein family...		Potri.016G090100 [exp]	18.38	0.6421
AT5G51570			SPFH/Band 7/PHB domain-contain...		Potri.015G130600 [exp]	20.71	0.5964
AT3G60800			DHHC-type zinc finger family p...		Potri.003G115600 [exp]	22.71	0.5934
AT4G22220		ATISU1, ISU1	SufE/NifU family protein (.1)		Potri.012G081700 [exp]	22.84	0.7035

Compare expression of checked genes

Potri.009G165700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.