Plant FIBer expression Database

Potri.009G167700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G42000 36 / 0.0009 AtMT4a Arabidopsis thaliana metallothionein 4a, Plant EC metallothionein-like protein, family 15 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G206400
[exp]
82 / 4e-22 AT2G42000 69 / 1e-16 Arabidopsis thaliana metallothionein 4a, Plant EC metallothionein-like protein, family 15 (.1.2)
Flax homologues

No hit found
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0461 Metallothionein PF02068 Metallothio_PEC Plant PEC family metallothionein
Representative CDS sequence
>Potri.009G167700.3 pacid=42772685 polypeptide=Potri.009G167700.3.p locus=Potri.009G167700 ID=Potri.009G167700.3.v4.1 annot-version=v4.1
ATGGCAGATACCAGGGGAGGTACTGTGGGTTTTAATGATGGGGATGGATGTCCTGTTCCATGCCCTGGTGGCACAGCCCGCAGGTGTGGTTCAGTCAAGG
ATACAAGCGGAGAGGGAGAGGGAGCTGGACACAAAAAATGCTCATGTGGCGAGCACTACTGTGGCTGCAATCCATGCACATGCCCCAGGAGCGTGGTGAC
CACCGGCGTGGGCAAGGCCTACTGTACGTGTGGTGCTGGTTGTGCTTGTCCGACTTGCAGTTCTTGA
AA sequence
>Potri.009G167700.3 pacid=42772685 polypeptide=Potri.009G167700.3.p locus=Potri.009G167700 ID=Potri.009G167700.3.v4.1 annot-version=v4.1
MADTRGGTVGFNDGDGCPVPCPGGTARRCGSVKDTSGEGEGAGHKKCSCGEHYCGCNPCTCPRSVVTTGVGKAYCTCGAGCACPTCSS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G23240 AtMT4b Arabidopsis thaliana metalloth... Potri.009G167700
[exp]
0 1
AT1G75220 AtERDL6 ERD6-like 6, Major facilitator... Potri.005G122550
[exp]
3.00 0.8478
AT3G27120 P-loop containing nucleoside t... Potri.001G331300
[exp]
5.47 0.8236
AT3G26040 HXXXD-type acyl-transferase fa... Potri.015G126600
[exp]
11.13 0.5766
AT3G10080 RmlC-like cupins superfamily p... Potri.008G020800
[exp]
11.48 0.7063
Potri.015G072732
[exp]
11.83 0.8102
AT5G65840 Thioredoxin superfamily protei... Potri.007G007201
[exp]
12.24 0.8102
Potri.013G159901
[exp]
15.87 0.7282
AT5G01075 Glycosyl hydrolase family 35 p... Potri.014G017600
[exp]
16.24 0.7459
Potri.014G116166
[exp]
16.73 0.7631
AT5G23960 ATTPS21 terpene synthase 21 (.1.2) Potri.011G130666
[exp]
18.33 0.7193

Potri.009G167700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.