Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G38140 85 / 7e-22 RING/U-box superfamily protein (.1) AT4G00305 67 / 4e-15 RING/U-box superfamily protein (.1) AT1G63840 66 / 2e-14 RING/U-box superfamily protein (.1) AT4G10150 65 / 2e-13 RING/U-box superfamily protein (.1) AT3G61460 64 / 2e-13 BRH1 brassinosteroid-responsive RING-H2 (.1) AT3G43430 61 / 3e-12 RING/U-box superfamily protein (.1) AT5G41400 60 / 4e-12 RING/U-box superfamily protein (.1) AT4G11360 59 / 1e-11 RHA1B RING-H2 finger A1B (.1) AT3G18930 61 / 2e-11 RING/U-box superfamily protein (.1.2) AT4G10160 59 / 2e-11 RING/U-box superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G209600 [exp] 182 / 2e-60 AT4G38140 88 / 3e-23 RING/U-box superfamily protein (.1) Potri.001G101000 [exp] 66 / 3e-14 AT3G61460 171 / 9e-55 brassinosteroid-responsive RING-H2 (.1) Potri.003G130900 [exp] 64 / 1e-13 AT1G63840 197 / 4e-65 RING/U-box superfamily protein (.1) Potri.014G087700 [exp] 62 / 6e-13 AT3G61460 220 / 2e-74 brassinosteroid-responsive RING-H2 (.1) Potri.002G161900 [exp] 62 / 1e-12 AT3G61460 234 / 7e-80 brassinosteroid-responsive RING-H2 (.1) Potri.008G165900 [exp] 62 / 4e-12 AT1G04360 312 / 2e-104 RING/U-box superfamily protein (.1) Potri.013G095100 [exp] 61 / 5e-12 AT4G10150 159 / 3e-48 RING/U-box superfamily protein (.1) Potri.016G067900 [exp] 59 / 8e-12 AT2G35910 129 / 7e-38 RING/U-box superfamily protein (.1) Potri.006G217000 [exp] 59 / 1e-11 AT5G20885 138 / 8e-42 RING/U-box superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024657 [exp] 70 / 2e-15 AT3G61460 200 / 4e-66 brassinosteroid-responsive RING-H2 (.1) Lus10032290 [exp] 70 / 2e-15 AT3G61460 200 / 2e-66 brassinosteroid-responsive RING-H2 (.1) Lus10036378 [exp] 67 / 2e-14 AT3G61460 210 / 5e-70 brassinosteroid-responsive RING-H2 (.1) Lus10028773 [exp] 67 / 2e-14 AT3G61460 169 / 4e-54 brassinosteroid-responsive RING-H2 (.1) Lus10017510 [exp] 66 / 4e-14 AT3G61460 176 / 6e-57 brassinosteroid-responsive RING-H2 (.1) Lus10032418 [exp] 59 / 3e-11 AT4G24015 180 / 9e-58 RING/U-box superfamily protein (.1) Lus10023055 [exp] 58 / 6e-11 AT4G24015 181 / 5e-58 RING/U-box superfamily protein (.1) Lus10015502 [exp] 58 / 1e-10 AT4G30400 251 / 1e-79 RING/U-box superfamily protein (.1) Lus10021197 [exp] 58 / 1e-10 AT1G04360 268 / 2e-87 RING/U-box superfamily protein (.1) Lus10013618 [exp] 58 / 1e-10 AT5G17600 220 / 1e-69 RING/U-box superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0229 [poplar] [flax] RING PF13639 [poplar] [flax] zf-RING_2 Ring finger domain
Representative CDS sequence Show only first row Show all	>Potri.009G170460.1 pacid=42771499 polypeptide=Potri.009G170460.1.p locus=Potri.009G170460 ID=Potri.009G170460.1.v4.1 annot-version=v4.1 ATGATTCCAGTTATGATGTATTCTCGCCAGTCTTCAGGCATTTGTATGGCTACTATTATATTTTACACATTCGTTCTCATTCCGCTCCGTCAAATCAAAC AGACTCTTTTCAGTATCATAGTACTACTCATGAGCAGCAGCAGCAGGAGGCTTGAGCCGGCAGAGATTGAGTACTGTTGCGACTGTAGTAGGCCTCCGCA GCAGCTTCTGCCAGTGCCCTCCAGGTTTGAAAAGTTGCAGGAGAAGGAGGTATGCTGCTCCATTTGCCTGATAGAGTTGGAGAAAGAAGATGAGGTGAGC CAACTCTCAAGGTGTATGCACGTCTTCCATATGGATTGCATTGAGAAATGGATACAGCGTGATCACTTCACCTGCCCACTCTGCAGGACCTCCATAGATC ATTAA
AA sequence Show only first row Show all	>Potri.009G170460.1 pacid=42771499 polypeptide=Potri.009G170460.1.p locus=Potri.009G170460 ID=Potri.009G170460.1.v4.1 annot-version=v4.1 MIPVMMYSRQSSGICMATIIFYTFVLIPLRQIKQTLFSIIVLLMSSSSRRLEPAEIEYCCDCSRPPQQLLPVPSRFEKLQEKEVCCSICLIELEKEDEVS QLSRCMHVFHMDCIEKWIQRDHFTCPLCRTSIDH

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G38140			RING/U-box superfamily protein...		Potri.009G170460 [exp]	0	1
AT1G23145		RALFL2	RALF-like 2 (.1)		Potri.017G140066 [exp]	4.89	0.6137
					Potri.019G108100 [exp]	21.63	0.5435
					Potri.008G057232 [exp]	25.59	0.5898
AT2G47485			unknown protein		Potri.010G119200 [exp]	38.49	0.4864
AT4G00120	bHLH	IND1, GT140, bH...	INDEHISCENT, EMBRYO SAC DEVELO...		Potri.005G060900 [exp]	69.49	0.5352
AT2G19320			unknown protein		Potri.006G073300 [exp]	89.86	0.4795
AT1G22220		AUF2	auxin up-regulated f-box prote...		Potri.001G021900 [exp]	92.37	0.5174
					Potri.015G020950 [exp]	154.07	0.4844

Compare expression of checked genes

Potri.009G170460 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.