Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-BETV1.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G24020 67 / 1e-14 MLP423 MLP-like protein 423 (.1.2) AT1G70850 54 / 5e-09 MLP34 MLP-like protein 34 (.1.2.3) AT5G28010 49 / 1e-07 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT1G70840 47 / 4e-07 MLP31 MLP-like protein 31 (.1) AT1G70880 47 / 7e-07 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT1G70830 46 / 1e-06 MLP28 MLP-like protein 28 (.1.2.3.4.5) AT5G28000 45 / 2e-06 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT5G45860 42 / 5e-05 RCAR5, PYL11 regulatory components of ABA receptor 5, PYR1-like 11 (.1) AT1G23130 39 / 0.0004 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G213669 [exp] 185 / 6e-61 AT1G24020 68 / 8e-15 MLP-like protein 423 (.1.2) Potri.008G213446 [exp] 185 / 6e-61 AT1G24020 68 / 8e-15 MLP-like protein 423 (.1.2) Potri.008G212700 [exp] 185 / 6e-61 AT1G24020 68 / 8e-15 MLP-like protein 423 (.1.2) Potri.008G212100 [exp] 167 / 7e-54 AT1G24020 50 / 6e-08 MLP-like protein 423 (.1.2) Potri.014G152800 [exp] 165 / 7e-53 AT1G24020 54 / 1e-09 MLP-like protein 423 (.1.2) Potri.011G025900 [exp] 163 / 5e-52 AT1G24020 55 / 7e-10 MLP-like protein 423 (.1.2) Potri.011G025966 [exp] 163 / 5e-52 AT1G24020 55 / 7e-10 MLP-like protein 423 (.1.2) Potri.004G021100 [exp] 161 / 3e-51 AT1G24020 53 / 4e-09 MLP-like protein 423 (.1.2) Potri.011G026100 [exp] 160 / 4e-51 AT1G24020 54 / 2e-09 MLP-like protein 423 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003187 [exp] 145 / 5e-45 AT5G45860 46 / 1e-06 regulatory components of ABA receptor 5, PYR1-like 11 (.1) Lus10016840 [exp] 140 / 7e-43 AT1G24020 58 / 5e-11 MLP-like protein 423 (.1.2) Lus10037715 [exp] 136 / 3e-41 AT1G24020 54 / 2e-09 MLP-like protein 423 (.1.2) Lus10016839 [exp] 105 / 2e-29 ND / Lus10014508 [exp] 100 / 5e-27 ND / Lus10032178 [exp] 96 / 2e-25 ND / Lus10015339 [exp] 96 / 2e-25 ND 41 / 6e-05 Lus10039454 [exp] 93 / 2e-24 AT1G24020 43 / 1e-05 MLP-like protein 423 (.1.2) Lus10005608 [exp] 76 / 5e-18 ND / Lus10037393 [exp] 53 / 4e-09 AT2G26040 39 / 5e-04 regulatory components of ABA receptor 14, PYR1-like 2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0209 [poplar] [flax] Bet_v_1_like PF00407 [poplar] [flax] Bet_v_1 Pathogenesis-related protein Bet v 1 family
Representative CDS sequence Show only first row Show all	>Potri.010G000600.1 pacid=42798696 polypeptide=Potri.010G000600.1.p locus=Potri.010G000600 ID=Potri.010G000600.1.v4.1 annot-version=v4.1 ATGGGTGTCATCACTTGTGAAAAAGAGATAGCTTTATCAATCCCTCCAGCCAAAATATTCAAGGCTTTTGTCCTTGATGGTAACCATCTCATTCCTAAGG CTGTGCCAGGGGTTATTGAGAGTTTAGCCCTTCTTGAAGGAGATGGAGGGCCTGGATCCATCAAGCAAGTTAATTTTGGTGAAGGTACTGGATACAAGTA TGTGAAGGAGAGGATTGATGTGATAGACAAGGAGAACTGCATTTATGAATACACTATGATAGAAGGTGATGTCTTGGGGAGTGAATTTGAGAAAGTGTCC AATGTGGTTAAATTTGAGGCCTCGCCTGATGGAGGATCCATCTGCAAGGGCAGCAGCAAGTACTACACTATTGGTGATATTAAGGTCAATGAAGAGGAAA TAGACGCTTTTAAAGAAAAGCAAATGGGACTCTTCAAGGCCATTGAAGCCTACCTTTTGGCAAATCCTGATGCTTAA
AA sequence Show only first row Show all	>Potri.010G000600.1 pacid=42798696 polypeptide=Potri.010G000600.1.p locus=Potri.010G000600 ID=Potri.010G000600.1.v4.1 annot-version=v4.1 MGVITCEKEIALSIPPAKIFKAFVLDGNHLIPKAVPGVIESLALLEGDGGPGSIKQVNFGEGTGYKYVKERIDVIDKENCIYEYTMIEGDVLGSEFEKVS NVVKFEASPDGGSICKGSSKYYTIGDIKVNEEEIDAFKEKQMGLFKAIEAYLLANPDA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Potri.010G000600 [exp]	0	1	Pt-BETV1.1
AT2G16720	MYB	AtY49, AtMYB7	ARABIDOPSIS THALIANA MYB DOMAI...		Potri.018G049200 [exp]	2.82	0.8598
AT1G68560		AXY3, TRG1, XYL...	thermoinhibition resistant ger...		Potri.008G120000 [exp]	10.09	0.8691	XYL1.2
AT1G69530		ATHEXPALPHA1.2,...	EXPANSIN 1, expansin A1 (.1.2....		Potri.004G123200 [exp]	24.55	0.8606	Pt-EXP2.4
AT3G15850		JB67, FADB, ADS...	FATTY ACID DESATURASE B, fatty...		Potri.011G152100 [exp]	31.85	0.8590
AT1G29450			SAUR-like auxin-responsive pro...		Potri.004G181500 [exp]	35.32	0.8589
					Potri.011G006500 [exp]	37.78	0.8586
AT3G20820			Leucine-rich repeat (LRR) fami...		Potri.003G207000 [exp]	43.86	0.8341	Pt-PGI.2
AT4G22010		SKS4	SKU5 similar 4 (.1)		Potri.004G010100 [exp]	44.21	0.7928
					Potri.008G104900 [exp]	44.49	0.8581
AT1G29140			Pollen Ole e 1 allergen and ex...		Potri.011G111300 [exp]	48.33	0.8583

Compare expression of checked genes

Potri.010G000600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.