Plant FIBer expression Database

Potri.010G001200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G213600
[exp]
41 / 9e-05 ND /
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.010G001200.1 pacid=42800076 polypeptide=Potri.010G001200.1.p locus=Potri.010G001200 ID=Potri.010G001200.1.v4.1 annot-version=v4.1
ATGGAGACAAGGCACAAACTCAAACTCTCACTTCTAGCCCTCTTCATGCTACTACCCTCAACAAAATCCTCAACAATGCCAAAGTCAAGGATGTTGTACC
AGATTGCATGCACAATGTGCTCCACATGTTGTGGCAGTACCCCAGTTCCATCACCACCACCACCCTCCCCGCCGCCACCAGCAGCATCACCACCTCCACC
AGCCACCACCGCCATCTGCCCGCCACCGCCATCACCACCACCATCAGGAGGGGGCTCTTACTATTACTCTCCACCTCCGCCTTCCACTTACACTTACTCC
TCACCACCACCACCACAAGGTGGTGTCGTTGGTGGCACTTACTATCCTCCACCAAATTACAAGAACTATCCCACACCCCCACCTCCTAACCCAATTGTCC
CCTACTTCCCTTTTTACTACTACAGCCCCCCGCCTCCTTCCATGTCTGCTTCTTTCAAGTTGATGGCTTCTTACAGTACCAGTGTGCTTGTGGGGGTGGT
TGCCTTGGTACTTTGCTTGTTTTGA
AA sequence
>Potri.010G001200.1 pacid=42800076 polypeptide=Potri.010G001200.1.p locus=Potri.010G001200 ID=Potri.010G001200.1.v4.1 annot-version=v4.1
METRHKLKLSLLALFMLLPSTKSSTMPKSRMLYQIACTMCSTCCGSTPVPSPPPPSPPPPAASPPPPATTAICPPPPSPPPSGGGSYYYSPPPPSTYTYS
SPPPPQGGVVGGTYYPPPNYKNYPTPPPPNPIVPYFPFYYYSPPPPSMSASFKLMASYSTSVLVGVVALVLCLF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.010G001200
[exp]
0 1
AT5G60920 COB COBRA-like extracellular glyco... Potri.015G060000
[exp]
1.00 0.8261
AT5G45280 Pectinacetylesterase family pr... Potri.003G046200
[exp]
4.69 0.8083
AT5G05800 unknown protein Potri.006G116400
[exp]
4.89 0.7250
AT3G49220 Plant invertase/pectin methyle... Potri.015G013700
[exp]
5.29 0.7820 PME2.12
AT2G17120 LYM2 lysm domain GPI-anchored prote... Potri.004G183500
[exp]
5.47 0.8073
AT1G29470 S-adenosyl-L-methionine-depend... Potri.005G184500
[exp]
9.16 0.7373
AT1G70210 ATCYCD1;1, CYCD... CYCLIN D1;1 (.1) Potri.009G086700
[exp]
9.89 0.7513
AT2G22490 CYCD2;1, ATCYCD... Cyclin D2;1 (.1.2) Potri.001G292300
[exp]
10.19 0.7918
AT1G04520 PDLP2 plasmodesmata-located protein ... Potri.008G171700
[exp]
12.00 0.7849
AT3G51740 IMK2 inflorescence meristem recepto... Potri.016G126300
[exp]
13.96 0.7882 Pt-RHG1.4

Potri.010G001200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.