Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G05858 72 / 4e-18 unknown protein AT5G26620 71 / 7e-18 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G001900 [exp] 45 / 2e-07 AT3G05858 55 / 3e-11 unknown protein Potri.013G001800 [exp] 45 / 2e-07 AT3G05858 55 / 3e-11 unknown protein Potri.013G002000 [exp] 41 / 4e-06 AT3G05858 54 / 5e-11 unknown protein Potri.005G002600 [exp] 36 / 0.0004 AT5G26620 49 / 4e-09 unknown protein Potri.005G002500 [exp] 36 / 0.0004 AT5G26620 49 / 4e-09 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001512 [exp] 44 / 5e-07 AT5G26620 53 / 1e-10 unknown protein Lus10031447 [exp] 44 / 5e-07 AT5G26620 53 / 1e-10 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.010G003900.1 pacid=42797276 polypeptide=Potri.010G003900.1.p locus=Potri.010G003900 ID=Potri.010G003900.1.v4.1 annot-version=v4.1 ATGGGAGGGTACAGCAGGCAGAGGAAATCTTCATCGTGCTTATTCTCTATATTCAGCATATTCAAGTCTTGTTGTTACTCAAGTGGCAGCGATGACATGA GTGAAGATGGGTATTATGTAAGGAGAGCATGTCCAAGTGATGAAGATGGAAGACGGTGGGTAGGAGAACCAGGGATTGATGGGAAGGCCTCAGCCTTCAT AGCAAGGTTCTATGCAACTAGGGTTTCAGACCCAGAACGCCAAACTCTTGCTCTCTGA
AA sequence Show only first row Show all	>Potri.010G003900.1 pacid=42797276 polypeptide=Potri.010G003900.1.p locus=Potri.010G003900 ID=Potri.010G003900.1.v4.1 annot-version=v4.1 MGGYSRQRKSSSCLFSIFSIFKSCCYSSGSDDMSEDGYYVRRACPSDEDGRRWVGEPGIDGKASAFIARFYATRVSDPERQTLAL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G05858			unknown protein		Potri.010G003900 [exp]	0	1
AT2G35910			RING/U-box superfamily protein...		Potri.010G243400 [exp]	2.00	0.9528
AT4G17800	AT-hook		Predicted AT-hook DNA-binding ...		Potri.003G091300 [exp]	3.16	0.9679
AT2G01170		BAT1	bidirectional amino acid trans...		Potri.007G100700 [exp]	5.83	0.9550
AT4G17870		RCAR11, PYR1	regulatory component of ABA re...		Potri.003G091700 [exp]	6.00	0.9321
AT4G17800	AT-hook		Predicted AT-hook DNA-binding ...		Potri.001G142800 [exp]	8.48	0.9538
AT3G03530		NPC4	non-specific phospholipase C4 ...		Potri.013G073600 [exp]	8.83	0.9360
AT4G14746			unknown protein		Potri.005G051900 [exp]	12.24	0.9515
AT1G15550		ATGA3OX1, GA4	GA REQUIRING 4, ARABIDOPSIS TH...		Potri.006G247700 [exp]	14.49	0.9409	Pt-WGA3.1
AT2G29120		ATGLR2.7	GLUTAMATE RECEPTOR 2.7, gluta...		Potri.014G028500 [exp]	14.69	0.9477
AT5G03700			D-mannose binding lectin prote...		Potri.008G016900 [exp]	15.29	0.9258

Compare expression of checked genes

Potri.010G003900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.