Potri.010G005000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G48350 229 / 4e-78 EMB3105 EMBRYO DEFECTIVE 3105, Ribosomal L18p/L5e family protein (.1)
AT1G14205 71 / 8e-16 Ribosomal L18p/L5e family protein (.1)
AT3G17626 62 / 2e-13 structural constituent of ribosome (.1)
AT5G27820 42 / 2e-05 Ribosomal L18p/L5e family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G087100 75 / 3e-17 AT1G14205 202 / 2e-67 Ribosomal L18p/L5e family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038770 237 / 3e-81 AT1G48350 216 / 6e-73 EMBRYO DEFECTIVE 3105, Ribosomal L18p/L5e family protein (.1)
Lus10039092 236 / 1e-80 AT1G48350 216 / 6e-73 EMBRYO DEFECTIVE 3105, Ribosomal L18p/L5e family protein (.1)
Lus10030465 75 / 1e-17 AT1G14205 174 / 2e-56 Ribosomal L18p/L5e family protein (.1)
Lus10012820 74 / 1e-16 AT1G14205 182 / 2e-59 Ribosomal L18p/L5e family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0267 S11_L18p PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Representative CDS sequence
>Potri.010G005000.3 pacid=42797360 polypeptide=Potri.010G005000.3.p locus=Potri.010G005000 ID=Potri.010G005000.3.v4.1 annot-version=v4.1
ATGGGGAGCAGCGGTACTTGTTCTCTTTGGAGTGGGTTCTTAGGCAGTGGGGGGCAGCAGCTCCGGGCATCGGTGGCAGCAGCCAAGCAGAGGACAAGCC
CAAGTCTAAGCTTTGTAACAGTTGAAGCCAAAGCCAAAACTAGACGCGAAGACAGGACTGCTCGCCATATTCGTATCAGAAAGAAGGTGGAAGGGACTCC
AGATAGGCCTAGATTGTGTGTCTTCCGTTCCAACAAGCATCTCTACGTCCAAGTGATTGATGATACAAAGATGCACACGCTCGCTTCCGCTTCAACCATG
CAGAAGCCCTTCGCTCAGGACTTTGATTACTCTTCTGGTCCAACCATTGATGTAGCTAAGAAGGTAGGTGAAGTCATTGCAAAATCTTGTTTAGAGAAGG
GGATAACTAAGGTGGCTTTTGACAGAGGTGGGTACCCTTATCATGGGCGTGTAGCAGCCCTTGCAGATGCAGCTCGGGAAAATGGCCTTCAATTCTAG
AA sequence
>Potri.010G005000.3 pacid=42797360 polypeptide=Potri.010G005000.3.p locus=Potri.010G005000 ID=Potri.010G005000.3.v4.1 annot-version=v4.1
MGSSGTCSLWSGFLGSGGQQLRASVAAAKQRTSPSLSFVTVEAKAKTRREDRTARHIRIRKKVEGTPDRPRLCVFRSNKHLYVQVIDDTKMHTLASASTM
QKPFAQDFDYSSGPTIDVAKKVGEVIAKSCLEKGITKVAFDRGGYPYHGRVAALADAARENGLQF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G48350 EMB3105 EMBRYO DEFECTIVE 3105, Ribosom... Potri.010G005000 0 1
AT5G42765 unknown protein Potri.014G196800 1.41 0.9815
AT2G45190 YABBY FIL, YAB1, AFO YABBY1, FILAMENTOUS FLOWER, AB... Potri.014G066700 6.48 0.9592 Pt-AFO.1
AT1G50900 LTD, GDC1 LHCP translocation defect, Gra... Potri.001G420900 6.63 0.9632
AT1G50320 ATHX, ATX thioredoxin X (.1) Potri.007G074000 9.48 0.9616
AT4G01310 Ribosomal L5P family protein (... Potri.002G154600 10.24 0.9632
AT1G13820 alpha/beta-Hydrolases superfam... Potri.010G158800 10.58 0.9544
AT1G67090 RBCS1A ribulose bisphosphate carboxyl... Potri.017G114600 13.56 0.9587
AT1G18810 phytochrome kinase substrate-r... Potri.015G062600 14.49 0.9476
AT3G26744 bHLH SCRM, ATICE1, I... SCREAM, A. THALIANA INDUCER OF... Potri.012G106000 15.00 0.9198 ICE1.2
AT2G24270 ALDH11A3 aldehyde dehydrogenase 11A3 (.... Potri.018G109700 16.58 0.9573 Pt-ALDH11.1

Potri.010G005000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.