Potri.010G005300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G39700 54 / 5e-09 Heavy metal transport/detoxification superfamily protein (.1)
AT4G35060 52 / 3e-08 HIPP25 heavy metal associated isoprenylated plant protein 25, Heavy metal transport/detoxification superfamily protein (.1)
AT5G66110 52 / 4e-08 HIPP27 heavy metal associated isoprenylated plant protein 27, Heavy metal transport/detoxification superfamily protein (.1)
AT1G29100 51 / 6e-08 Heavy metal transport/detoxification superfamily protein (.1)
AT1G06330 51 / 8e-08 Heavy metal transport/detoxification superfamily protein (.1)
AT5G27690 52 / 1e-07 Heavy metal transport/detoxification superfamily protein (.1)
AT4G38580 50 / 1e-07 HIPP26, ATFP6 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1)
AT3G56891 50 / 2e-07 Heavy metal transport/detoxification superfamily protein (.1)
AT4G08570 49 / 3e-07 Heavy metal transport/detoxification superfamily protein (.1)
AT1G56210 50 / 9e-07 Heavy metal transport/detoxification superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G065600 62 / 1e-11 AT1G06330 159 / 7e-51 Heavy metal transport/detoxification superfamily protein (.1)
Potri.019G106500 57 / 5e-10 AT1G06330 217 / 1e-73 Heavy metal transport/detoxification superfamily protein (.1)
Potri.019G107500 56 / 1e-09 AT1G06330 213 / 5e-72 Heavy metal transport/detoxification superfamily protein (.1)
Potri.005G003700 56 / 2e-09 AT4G08570 207 / 5e-70 Heavy metal transport/detoxification superfamily protein (.1)
Potri.005G167000 55 / 2e-09 AT4G08570 229 / 1e-78 Heavy metal transport/detoxification superfamily protein (.1)
Potri.004G175400 54 / 5e-09 AT4G38580 254 / 2e-88 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1)
Potri.002G092200 54 / 5e-09 AT4G08570 193 / 3e-64 Heavy metal transport/detoxification superfamily protein (.1)
Potri.009G135300 53 / 1e-08 AT4G38580 234 / 3e-80 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1)
Potri.005G079800 53 / 2e-08 AT4G39700 189 / 2e-62 Heavy metal transport/detoxification superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033469 100 / 4e-24 AT5G27690 56 / 2e-09 Heavy metal transport/detoxification superfamily protein (.1)
Lus10020906 96 / 1e-22 AT5G27690 50 / 1e-06 Heavy metal transport/detoxification superfamily protein (.1)
Lus10016812 56 / 3e-09 AT4G39700 181 / 3e-59 Heavy metal transport/detoxification superfamily protein (.1)
Lus10022508 55 / 3e-09 AT4G39700 201 / 2e-67 Heavy metal transport/detoxification superfamily protein (.1)
Lus10013911 54 / 1e-08 AT1G06330 103 / 2e-28 Heavy metal transport/detoxification superfamily protein (.1)
Lus10039419 53 / 2e-08 AT4G08570 215 / 5e-73 Heavy metal transport/detoxification superfamily protein (.1)
Lus10019676 52 / 3e-08 AT4G39700 211 / 3e-71 Heavy metal transport/detoxification superfamily protein (.1)
Lus10016436 52 / 3e-08 AT4G39700 209 / 1e-70 Heavy metal transport/detoxification superfamily protein (.1)
Lus10019789 52 / 4e-08 AT4G38580 254 / 4e-88 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1)
Lus10014120 52 / 4e-08 AT4G38580 253 / 5e-88 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00403 HMA Heavy-metal-associated domain
Representative CDS sequence
>Potri.010G005300.2 pacid=42798991 polypeptide=Potri.010G005300.2.p locus=Potri.010G005300 ID=Potri.010G005300.2.v4.1 annot-version=v4.1
ATGTTTCCAGAGTTAGAGAAACCTCGAGTCACGGAGATACAAGTCCGAATGGACTGTAATGGGTGTGTGCAGAAGATCAAGAAGGCATTGCATGGCATCA
ATGGTATATATGATCTCTACATTGACTTCCCACAGCAGAAGCTGACAGTCATTGGGTGGGCAGATCCCGAAAAAATTATCAAGGCGATTAGGAAAACTAG
GAAAATTGCCACCATATGTTCCCATTCTGAACCATCAGATCCTGCTGCTCAGACAACAGAAAAACCACCCGAACAAGCACCTGAAGGTGGGGCACCGCCA
CCACCGGTCTCCGACCAGGCAAATCCTCCCACAGCAGAAGCTCCACCTGCTGAAACAGCAGCTTCAACAGCAGAGCCTCCAAAAGATCCACCACAACCTG
AGAACCCGCCACCACCTGGGGAGAATCCATCACCTGTTGCTGAAGAAACCAACGCAAATCAGCCACAAAGGCCCCCTGGACCCAAAGATTCAGGAGAGGT
TCATGTTATATACCATCACCCACCTGACTATGGCTACAGATATGCTTATGGTCATAACTATGGCGGTAACTGGAACAGACACCCTATTAGCCAAGGAGTC
CCACAAGCGGCGCCAAAGCCCATCTACGTGACTCACAGCTACAACACATACAGGCCATCACCGAATGTCACTGAATATGAATATCTCCGACCACCACCAC
CACATCACACAATTTACAGTAGGATGGACCACTACAATGAGGATTATCATGACAACAGTCGCAGTAATAATGGAAACATTACATCTATGTTTAGCGATGA
GAATCCAAATGCTTGCCGAATAATGTGA
AA sequence
>Potri.010G005300.2 pacid=42798991 polypeptide=Potri.010G005300.2.p locus=Potri.010G005300 ID=Potri.010G005300.2.v4.1 annot-version=v4.1
MFPELEKPRVTEIQVRMDCNGCVQKIKKALHGINGIYDLYIDFPQQKLTVIGWADPEKIIKAIRKTRKIATICSHSEPSDPAAQTTEKPPEQAPEGGAPP
PPVSDQANPPTAEAPPAETAASTAEPPKDPPQPENPPPPGENPSPVAEETNANQPQRPPGPKDSGEVHVIYHHPPDYGYRYAYGHNYGGNWNRHPISQGV
PQAAPKPIYVTHSYNTYRPSPNVTEYEYLRPPPPHHTIYSRMDHYNEDYHDNSRSNNGNITSMFSDENPNACRIM

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G39700 Heavy metal transport/detoxifi... Potri.010G005300 0 1
AT1G07250 UGT71C4 UDP-glucosyl transferase 71C4 ... Potri.016G014300 2.44 0.9219
AT3G49780 ATPSK3(FORMERSY... phytosulfokine 4 precursor (.1... Potri.007G006800 4.00 0.9172 Pt-PSK3.1
AT3G12920 BRG3 BOI-related gene 3, SBP (S-rib... Potri.011G142700 5.47 0.9080
AT5G62680 Major facilitator superfamily ... Potri.001G351200 9.79 0.9174
AT2G46870 B3 NGA1 NGATHA1, AP2/B3-like transcrip... Potri.001G452200 10.48 0.8973
AT3G01470 HD HD-ZIP-1, HAT5,... HOMEODOMAIN PROTEIN FROM ARABI... Potri.015G065400 11.22 0.8793
AT2G22860 ATPSK2 phytosulfokine 2 precursor (.1... Potri.014G006900 12.84 0.8625 Pt-PSK3.2
AT2G01410 NHL domain-containing protein ... Potri.006G111600 13.00 0.8894
AT3G45260 C2H2ZnF C2H2-like zinc finger protein ... Potri.006G227600 17.49 0.8819
AT2G46370 FIN219, JAR1 JASMONATE RESISTANT 1, FAR-RED... Potri.002G168200 17.97 0.8811

Potri.010G005300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.